SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BNQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BNQ1
Domain Number 1 Region: 50-152
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000000966
Family Carbon-carbon bond hydrolase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3BNQ1
Sequence length 153
Comment (tr|H3BNQ1|H3BNQ1_HUMAN) Protein NDRG4 {ECO:0000313|Ensembl:ENSP00000454956} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NDRG4 OC=Catarrhini; Hominidae; Homo.
Sequence
MAGLQELRFPEEKPLLRGQDATELESSDAFLLAADTDWKEHDIETPYGLLHVVIRGSPKG
NRPAILTYHDVGLNHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPS
MEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLA
Download sequence
Identical sequences A0A2J8MVN1 A0A2J8VZJ4 H3BNQ1
ENSP00000454956 ENSP00000454956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]