SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BNQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BNQ7
Domain Number 1 Region: 40-458
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.38e-81
Family GABA-aminotransferase-like 0.00000000000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3BNQ7
Sequence length 515
Comment (tr|H3BNQ7|H3BNQ7_HUMAN) 4-aminobutyrate aminotransferase, mitochondrial {ECO:0000313|Ensembl:ENSP00000454963} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ABAT OC=Catarrhini; Hominidae; Homo.
Sequence
MASMLLAQRLACSFQHSYRLLVPGSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSQELMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQ
NASMFVNRPALGILPPENFVEKLRQSLLSVAPKGMSQLITMACGSCSNENALKTIFMWYR
SKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGG
DNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLTGLL
DLQARYPQFISRVRGRGTFCSFDTPDDSIRNKLILIARNKALPACDFEKPRSSPTSCLFQ
VWCWVAVVTNPFVSVPRWSSGITTLTCSSIFSVTS
Download sequence
Identical sequences H3BNQ7
ENSP00000454963 ENSP00000455502 ENSP00000454963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]