SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BWU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BWU6
Domain Number 1 Region: 90-140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000165
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 2 Region: 138-185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000179
Family Laminin-type module 0.038
Further Details:      
 
Weak hits

Sequence:  H3BWU6
Domain Number - Region: 2-36
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000232
Family Laminin-type module 0.012
Further Details:      
 
Domain Number - Region: 372-589
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000523
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.025
Further Details:      
 
Domain Number - Region: 48-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00106
Family Laminin-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3BWU6
Sequence length 611
Comment (tr|H3BWU6|H3BWU6_TETNG) Laminin, beta 2-like {ECO:0000313|Ensembl:ENSTNIP00000000459} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
GQCLKCLHHTEGPSCAQCQLGYYGNALAQDCRRCVCVTSGTKPSACSEGRCHCDRQSGAC
PCREHVEGHICDHCAPHHWNYGQAGGCQPCACDPDHAMGAHCNMFSGQCHCQPGFGGRQC
TECEQFHWGDPREQCQECNCHLLGSEVAQCDQDTGKCKCKVGMAGKRCDQCARGFVGPFP
TCAPCHPCFQLWDDTICQLERDLENIQLMVKKVVESSGTPGFGHMKIRKLEMKLMQVKNL
LSQVESQQIHHLIGQSIEDLRAEIAVTDGHLTAVSRELNTSAETDAALRDTLALMERQLT
DINATVARKRQLMEEYQTSGSADALMKVKKYHRESEKAEEKCNATVSGPLSPVEQSNSTR
TLIKDLLEASQDKLFQDLAAHNRSIEELQGKAQELDRTVHLLTQKVCGAPDSTSGVCTGS
QCGGEGCNGTVSVSVAAMNNANNVRDHLTAADEDLQGVNRKLKNIASLTLDVKNQVKHTL
EKAQKNKQHFETGNRKLKDFIQKIRDFLMEEGADPASIERVAQHVLSITLPVPRSTLEKM
ILQIKDSLANITDVGGIVNHSSQHITKAKELLSQAKDAKAQAEELKDVVNNTLQVLDMSE
EAARKARKALQ
Download sequence
Identical sequences H3BWU6
ENSTNIP00000000459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]