SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BWW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BWW0
Domain Number 1 Region: 645-840
Classification Level Classification E-value
Superfamily Sec7 domain 4.84e-76
Family Sec7 domain 0.00000188
Further Details:      
 
Domain Number 2 Region: 280-313,372-585,1140-1489
Classification Level Classification E-value
Superfamily ARM repeat 1.63e-28
Family Armadillo repeat 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3BWW0
Sequence length 1811
Comment (tr|H3BWW0|H3BWW0_TETNG) ADP-ribosylation factor guanine nucleotide-exchange factor 1 (brefeldin A-inhibited) {ECO:0000313|Ensembl:ENSTNIP00000000473} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
EEIKEESKKLSPTSGDAKSSSSTLPPIKSKANFIEADKYFLPFELACQSKCPRIVITSLD
CLQKLIAYGHLTGSAPDSTAPGKKLIDRIIETICACFQGPQTDEGVQLQIIKALLTAVTS
QHIEIHEGTVLQAVRTCYNIYLASKNLINQTTAKATLTQMLNVIFARMENQALQEAKQLE
RERHRQHSPVTQHTDTESPTLQTHSNPPNRAASQGQEGRGEQAEQEEQGPVYENPDPENG
SHYCVPENEQTEADQALAARETVEDEDEEAPNYEEKAQEIVQSILQDVVNTVAGAEAEPE
PAEAATDGVQNCIEDESTLGSDGEHVHANGIPGTPISATFTPSLPDDRLSVSSNDTQESG
VAPGQPPGAKFSHILQKDAFLVFRSLCKLSMKPLSDGPPDPKSHELRSKVLSLQLLLSIL
QNAGPIFKTNEMFINAIKQYLCVALSKNGVSSVPEVFELSLSIFLTLLSHFKTHLKMQIE
VFFKEIFLYILETSTSSYEHKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFERLVN
DLSKIAQGRAGHELGTTPLQELTLRKKGLECLVSILKCMVEWSKDQYVNPNSQTSLGQEK
PSEQENTDTKAPETINRYGSINSLDSTASSGIGSYSTQMSGTDNPEQFEVLKQQKEIIEQ
GIDLFNKKPKRGIQYLQEQGMLGTTPEDLAQFLHQEERLDSTQVGEFLGDNDRFNKEVMY
AYVDQMDFQGKDFVSALRMFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTA
YVLAYSIIMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSAIYDEIAGKKIAM
KETKELTMKSNKQSVASEKQRRLLYNVEMEQMAKTAKALMEAVSHVQAPFTSATHLEHVR
PMFKLAWTPFLAAFSVGLQDCDDTEVASLCLEGIRCAIRIACIFSIQLERDAYVQALARF
TLLTASSGITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEIMKCISQLELAQLIGTGVKA
RYISGTVRGKEGFITSTKEQNNDEYLGLVGGTVDRKQIASIQESIGETSSQSVVVAVDRI
FTGSTRLDGNAIVDFVRWLCAVSMDELASPTHPRMFSLQKIVEISYYNMGRIRLQWSRIW
EVIGDHFNKVGCNSNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNR
SPTIRDMVVRCIAQMVNSQAANIRSGWKNIFSVFHLAASDQDESIVELAFQTTGHIVTNV
FEKHFAATIDSFQDAVKCLSEFACNASFPDTSMEAIRLIRHCAKYVSDRPQAFKDYTSDD
MNVATEDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEVMKTYGHTFEKHWWQDLF
RIVFRIFDNMKLPEQQTEKAEWMTTTCNHALYAICDVFTQYFEALNDVLLDDILAQLYWC
VQQDNEQLARSGTNCLENVVILNGEKFSPETWDKTCNCMLDIFITTIPHALLTWRPAGAE
GEHVTTQALSDKQLDSISQKSLDIQSRSDDQHSISSADRSTTDNHRQSHYSSGSGVGEDG
SRSRTPTKVPEHRLFAALLIKCVVQLELIQTIDNIVFFPATSKKEDAENFAAAQRDASHV
ADLPAETQDQGMYRYLTSQQLFKLLDCLLESHRFAKAFNSNNEQRTLLWKAGFKGKSKPN
LLKQETSSLACGLRILFRMYTDESRQDAWEEVQRRLLNVCSEAVAYFLALTSESHREAWT
NLLLLFLTKVLKISDERFKAHASRYYSLLCEIMQLDLIPELRAVLRKFYLRIGAVFHIAQ
LPEAEPDRPAS
Download sequence
Identical sequences H3BWW0
99883.ENSTNIP00000000473 ENSTNIP00000000473 ENSTNIP00000000473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]