SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BWX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BWX4
Domain Number 1 Region: 72-154
Classification Level Classification E-value
Superfamily SEA domain 0.0000000942
Family SEA domain 0.019
Further Details:      
 
Domain Number 2 Region: 215-303
Classification Level Classification E-value
Superfamily SEA domain 0.000000126
Family SEA domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3BWX4
Sequence length 362
Comment (tr|H3BWX4|H3BWX4_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000000487} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MIKPDSATSPPANTTSLLGNATSLPATVTSHPANVTLAPIHAASSPVQQAGTTTVAPLAN
SKINLEFKLQRSFTSQLLNQSSPEFMELATTVKAALDEVYSKRFGRGFLQSIIKSFSQGS
VVVNSELIFRNSSSVPDTAAVVSALVEAASNNSNFSIPVNVSTIVATPSTVSVASTAFAA
SHTSVDITSTQSTTTASTNPPTSSEGTLGLTFSLDQTFTSDLSDQTSAAFQTLAATVIKV
INTACLKLFGSVFSRSIVNSFTSGSVNVNMTLVFTSKNAVPSASNATSLLRSELSNSTLN
IIPGSISAYSTSTSSMAIRPTIGKQKFEVRSEVKRLNSLNPKSLSETAHALCPTVLPPSP
LR
Download sequence
Identical sequences H3BWX4
99883.ENSTNIP00000000487 ENSTNIP00000000487 ENSTNIP00000000487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]