SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BX24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BX24
Domain Number 1 Region: 230-291
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0043
Further Details:      
 
Domain Number 2 Region: 370-425
Classification Level Classification E-value
Superfamily BPTI-like 1.31e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0026
Further Details:      
 
Domain Number 3 Region: 316-353
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000011
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 4 Region: 142-233
Classification Level Classification E-value
Superfamily PKD domain 0.000000445
Family PKD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3BX24
Sequence length 508
Comment (tr|H3BX24|H3BX24_TETNG) Serine peptidase inhibitor, Kunitz type 1 {ECO:0000313|Ensembl:ENSTNIP00000000537} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=SPINT1 OC=Tetraodon.
Sequence
MESLLGARLGARCLLVAALLLHSSLGQEVGDGCLADFQKGKDDFILDTDESVKDGATFLS
SPNLGRYRDCVGACCKEPKCNVAFMERGEEEGSISSCFLFDCLYKMKYACRFVKKKGFSS
YIQDTLYESYLSVDQAPHSQDRPPVANGGQDRVVQPQDIVMLNGVQSKDDKAIVSYQWQM
LTSYPYAIIEKTNFKDQIMVSNLTSGVYKFQLTVTDTIGQSDSVKVTVMVLTPEQSDHHC
MAPMKVGPCRGSFPRWHYNAASQKCEAFTFGGCRENLNNYLSEDECNKACSGSEKSSKTG
RALPLPGDQVEKCNTPCTTEEFTCDNGCCLDPGLECDSTPQCSDGSDERKCDDLNNTFNR
LLQIPVNEQKMRCTELPDTGSCRDSLTKWYYNPVKQECSRFNYGGCQGNENRFETQDSCA
KFCRGITEKDVFARIEEFERTTATSNTVVVVIAALLGLAIFILLAILLYCLVKGRRKSGQ
HQRVPANTIPVTFEDRERLVYNTTTKPI
Download sequence
Identical sequences H3BX24
ENSTNIP00000000537 ENSTNIP00000000537 99883.ENSTNIP00000000537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]