SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BX79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BX79
Domain Number 1 Region: 21-70
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 7.06e-19
Family Cysteine-rich DNA binding domain, (DM domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 228-277
Classification Level Classification E-value
Superfamily UBA-like 0.000000357
Family UBA domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3BX79
Sequence length 459
Comment (tr|H3BX79|H3BX79_TETNG) Doublesex and mab-3 related transcription factor 3a {ECO:0000313|Ensembl:ENSTNIP00000000592} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MNGYGSPYLYMGAPVSQPRAPLQRTPKCARCRNHGVLSWLKGHKRYCRFKDCTCEKCILI
IERQRVMAAQVALRRQQANESLESLIPESLRVLPGIGMAAGGEGSQGAGPRSEELELRWS
SPEPQAAPATRAEAAEDPEEASGAENGGSCSDREQDAVSSPEGSKPNSCYTPEPPEPPSH
PDEGRYSLPKAGSSEKEARAQSPRKHGGSPAEQSVLVEGLGGSINLPFSLRANRPPLEVL
KKIFPAHKPPVLELILRGCGGDLVGAIEVLLSSRSADGSAHPHTDPHPDSVVLPSSGHLF
EHTLASYHPVSSSAKWSVGSAFRVPETLRFSSDSAAGMVSSSPLGVPVQPSPFPPHARYP
LMLRNSLTRSQASPFVHNDVALWNTVALQQQYQLRSAAHYVSPFVFRSSPVLSPRPSEEQ
RAGMPEESCTLGPKPGLYSPEEEYEERSDSADSRVINAS
Download sequence
Identical sequences H3BX79
ENSTNIP00000000592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]