SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BXA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BXA4
Domain Number 1 Region: 104-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000838
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 2 Region: 64-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000041
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  H3BXA4
Domain Number - Region: 18-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00742
Family EGF-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3BXA4
Sequence length 737
Comment (tr|H3BXA4|H3BXA4_TETNG) Adhesion G protein-coupled receptor L4 {ECO:0000313|Ensembl:ENSTNIP00000000617} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
STKQLWVVYVRTMAHRLSKRSCKSDSCHQLATCEAQNESKAGCYCKHGYTGDGTTFCDDP
DDNECQNVTNICGERGNCTNTEGSYYCTCLPGYESTGNSSFQPNDGTECIDIDECQWAKE
RCGLNSHCHNTYGSFYCTCQRDYIPTSGTRHFHSGKVVKCKENPQKYCHHSIECITETIN
QTLENMRNFTEPQDLLKEIVKQTSGELSAVEVITYVEALSRSTSILVSTEKDASMEPSSI
NFTLTKLVNAANNLVEKDELAAWNRMKEEHRERTITKLLHTVEESALTLAKNYKIPTELQ
IKAPDMEMKLYTIDAGQTKARVSASMAGDHINLSPKLQAAKDRNGSVSVVFVHYDSVGAI
LEPSSSQGVAGTGEITVNSRVVAAAVRPADIYQLDHVTFTLRHNQEISDIEGDAIKCAFW
EYEPERLQGRWSTRGCRTLHVSSNATTCSCDHLTHFAILMSSGQANLGAHALVLTRITQL
GMIISLICLSMCIFTFWFFREIQSTRTTIHKNLCCSLFMAEFIFLVGINMTAHKLFCSVI
AGLLHYFFLAVFAWMCIEGIHLYLIVVGVIYNKGFLHRNFYIFGYGSPAVVVTISATLGS
KYYGTDKVCWLSTENHFVWSFIGPACLITLVNLLSFGVIIFKVYRHTAVKKPETSHYENI
RSCARGAIALFFVLGVTWTFGVLHILHETTLTAYLFTISNTFQGMFLFIFLCVLSRKIQE
EYYRLFKNVPCCFECLR
Download sequence
Identical sequences H3BXA4
ENSTNIP00000000617 99883.ENSTNIP00000000617 ENSTNIP00000000774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]