SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BXD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BXD7
Domain Number 1 Region: 572-690
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-22
Family Ankyrin repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3BXD7
Sequence length 712
Comment (tr|H3BXD7|H3BXD7_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000000650} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MAAGVVSAPLIIASSSSHTHASRREIHTDTLVFIQSADTPGALIFYTLDGSRPEPDQSGS
AARSRKYSKPVRLPAGRVAVRAVAVASDGRRSSTVTKMFVVQRREAGVEEKVPEVNQVSK
QRLGRHGDAGLKLKTAGVLASLQRCSDVPRGGGDPNSVSSLECCWGPLPVDPPHHHGEPA
SLPQKPVHGPPSGPVQGSDPLKQLRSTQTSRLVQDPEVLWDQQVLTARPPDPFSLFFPIC
GAKISHQTFPSRGTEQGHRVCGCCGSGNPVNVSSCLTCESCLQPQREPSSSGCWLASEDL
APWCGVSGPAPSLAAPACCAGAAAPAAILPPPGCASCGVFLRAPTPPTAPPGEEPLHGEV
VTKLDRFHAEAMTGGSQQATPPPDCAWKMLRPPQTDPRRPWGSSTRRPLRGSRAGGRRSP
RRRPPLTSVSPGKGYWRRQLDHVCAHLRSYTQNNAPFRALLGDPCMGQLLSAVVQDDQQQ
LTLTISFALAHQKTQVCGSTCTSSSTTPTQTGLGEGLDLFRSGSCDLPMGVWGEVHPHSH
THTRRGLTGGDVLPGGGASKPGRGRDAQLMMELAPGRGQLSIVQQLLDQGADPACCHSNG
RHPLALAVLNGHHQVLPELVQRGAPVDQQSGPMKNTALHEAAALAPEGLPAAELLLSCGA
SVGVKNASGQTAFQLAADSGCNQMVSLLAAQTGLVLLGKLASPSGNVQLGAN
Download sequence
Identical sequences H3BXD7
ENSTNIP00000000650 ENSTNIP00000000650 99883.ENSTNIP00000000650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]