SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BXD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BXD8
Domain Number 1 Region: 718-1067
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.67e-76
Family Ankyrin repeat 0.0000119
Further Details:      
 
Domain Number 2 Region: 1093-1216
Classification Level Classification E-value
Superfamily TPR-like 3.54e-21
Family Tetratricopeptide repeat (TPR) 0.0024
Further Details:      
 
Domain Number 3 Region: 151-233,329-410
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000854
Family Extended AAA-ATPase domain 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3BXD8
Sequence length 1645
Comment (tr|H3BXD8|H3BXD8_TETNG) Tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 2a {ECO:0000313|Ensembl:ENSTNIP00000000651} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
TLESRDSGIIATLTSYSENMERGGKYGEGSRGNLKQWHSQKSGMDSFLYRVDENMTASTY
SLNKIPERNLESMSSHSAHSIPLYLMPRPNSVAVVRLQKPATSSAHLEDLAYLDEQRHTP
LRTSLRMPRQSTTCGPGRSGQDLRVRFAPYRPQDIALKPLLFEVPSITMDSVFTGRDWLF
QEIDGHLNQPSSSTSRGVAVVGNIGFGKTAIVSRLVALSCHGTRMRQIASDSPQASPKHG
EGFPLSQPQTAHGTLGGGSCPGTPEMRRRQEEAMRRLASQVVAYHYCQADNAYTCLVPEF
VHNVAALLCRSPHLVAYREQLLREPHLQSILSLRSCVQDPLASFRRGVLEPLDALYKERK
IISEEDLIILIDGLNEAEFHKPDYGDTIVSFLTKTISRFPPWLKLVVTVRTTLQDITSDL
PFHRISLDGLEENDAIDQDLQGYILHRIHSSPEIQNNISLNGKMDNTTFGKLSAHLKALS
QGSYLYLKLTFDLIEKGYLVLKSSSYKVVPVNLAEVYLLQCNMRFPTQSSFERALPLLNV
AVASLHPLTDEQIYQAINAGSLQGTLDWEDFQQRVDNLSVFLVRRRDGTRMFVHPSFREW
LIWREEGEKTKFLCDPRSGHTLLAFWFSRQEKLNRQQTIELGHHILKAHIFKGLSKKVGV
SSSILQGLWVSYCTEGLSAALSSLRNLYTPNIKVSRLLMLGGANVNYRTEVLNNAPILCV
HSHLGYMEMVSLLLEFGASVDAPSESGLTPLCYAAAGGHMAIVSALCRRRAKVDHLDKNR
QCALVHAALRGHMEVVKFLIQCDWAPGQQQQQQSPQSQQQAALTKSHAVQQALIAAASMG
YTEIVSYLLDLPEKDEEEVERAQINNFDTLWGETALTAASGRGKLEVCRLLLEQGAAVAQ
PNRRGIVPLFSAVRQGHWQIVDLLLTHGADVNMADKQGRSPLMMAASEGHLETVEFLLAQ
GASLPLMDKEGLTALSWACLKGHLPVVRYLVESGAAPDHADKNGRTPLDLAAFYGDSEVV
QFLVDHGAMIEHVDYSGMRPLDRAVGCRNTSVVVALLKKGAKIGPATWAMATSKPDIMII
LLSKLIEEGDGFYKQKGKVKEAAQRYQYALKKFPREGFSEDLKTFRELKVSLFLNLSRCR
RKMNDFGMAEEFATKALELKPKSFEAYYARARAKRSSRQFTEALEDLKEAMKHSPNNREI
QRLLQRVEEECHQFSQQEHQQQGLELEPPPSPPPTPPPEEEESLSLPMPLPPPPEPRLED
MEPVQDLFEEPTSLPHPSGSQSGSPVRYQTEQLPGRPKSPLSKMSSQRSFQHHQAQGLRL
QPSIAQIVRTNQHGGRGGVMESGLLKDELPQRPSSAYRASSGGPGGIRYSQTPQISRSQS
AAYYPVSEHVLERTGVVPTCQLGSPEIPHMARRPVSANTTEMKQHVSAPRPLIHSQSVGL
RFSPSSNNISTGSTTNLAPSFRPSASIQQMEIPLQAAYEHACDDISPISPSQGGGALYQQ
GETTRSRNTPFMGVIDKTARTQQYLHQPSRSRAMTSMDPAISPTSPGQLVQQGSTYSPPA
SLEEDYYSQTPPQSLGKLTNGSRGVGDILERVSQVPTYQDVKVARTLPVAQAYQDNMYRQ
LSRDARTQGPTSPIKPKRPFVESNV
Download sequence
Identical sequences H3BXD8
ENSTNIP00000000651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]