SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BY57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BY57
Domain Number 1 Region: 227-405
Classification Level Classification E-value
Superfamily MIR domain 8.63e-46
Family MIR domain 0.0032
Further Details:      
 
Domain Number 2 Region: 1064-1183
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.37e-16
Family SPRY domain 0.046
Further Details:      
 
Domain Number 3 Region: 666-804
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000641
Family Galectin (animal S-lectin) 0.078
Further Details:      
 
Domain Number 4 Region: 4041-4103
Classification Level Classification E-value
Superfamily EF-hand 0.0000000562
Family Calmodulin-like 0.039
Further Details:      
 
Domain Number 5 Region: 2073-2084,2180-2226,2533-2602,2672-2697,2994-3029,3064-3207,3301-3430
Classification Level Classification E-value
Superfamily ARM repeat 0.000000249
Family MIF4G domain-like 0.077
Further Details:      
 
Domain Number 6 Region: 1428-1568
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000095
Family SPRY domain 0.043
Further Details:      
 
Domain Number 7 Region: 448-561
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000144
Family IP3 receptor type 1 binding core, domain 2 0.022
Further Details:      
 
Weak hits

Sequence:  H3BY57
Domain Number - Region: 102-183
Classification Level Classification E-value
Superfamily MIR domain 0.00366
Family MIR domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3BY57
Sequence length 4967
Comment (tr|H3BY57|H3BY57_TETNG) Ryanodine receptor 2b (cardiac) {ECO:0000313|Ensembl:ENSTNIP00000000922} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MSDFGEGDEEFQFLRTGDEVVLQSIFTLRGEHVKICLAAEGFGTRLCRLEPIFNCKNVPP
DVSVCGFVLAHCLSVRALQEMLTHTEHLAAELAAGGGHRTLLYGQAVLFLHSYSSMYLSC
LSSSQSATDKLAFDVGLQEDKEGETCWWIVHPSSRQRSEGEKVRVGDDLILVSMSSERYL
HLSVGSGSDSSSSLSDSLSVSASFQPTLWSVAPIYSGGGVAQGYLKGGDTFRLHHSHSDA
CLTIASADQGEEPQKVMHYESGAVSSHARSLWRLEILHVVWSGSHTCWGQPFRLCHMTTG
RYMGLTEERGLHLVERDKADVRMSSFCFRSSKEKLDPGTRTNADGMGSPEIKYGDSVCYV
QHVDSGLWLTYRPVDAKSSRLRSTQRKAILHSEGHMDDGLRLSRCQREESHTARLIRSAS
FLFTNFIRKQDSCSQHGNQVSVCSPGEMMKRSLQDLISYFYPTPETVEHEAKCHNMVVLK
NRQNMFQEEGVIDLVLVCIDHLHQHIGTSQCAEAAQEDSEEEWESCLDGFYKLLAALLRG
NRANCARFSASIDWLISKLDWLEAATGVLEVLQCVLLESPEALNVVKENHIHSVISFLDK
HGLNHKVLEVLCALCVCHGVAVRYNQNLICDKLLPERDLLLQTRLVNRVTSMRPNIFLAF
SEDSAQHRRWYYEVVVDHLDSFLTSEPTHLRVGWACTEGYRPRLSGGEGWGGNGVGDDLC
SYGFDGLHLWAGGVGRSVSSPFSHSLKDGDVVSCCLDLSAPCISFRVNGLPVQGMLENFV
AEGLLYPVVSFSAGVRIRFLFGGQHGEFRYLPPPGFTACSDALLPKVKLKVEPCQKYILN
REEGKHDLIGPWIPTAPVVFIPAPVDISKVSLPPQLEDIQEKLAENIHELWAMDKIDLGW
TYGPVRDEAKKNDPSLAEFSKLSEHERNQNLHVAQDTLRTLLAFGFCIGFNEGHSNDRVR
NKRLAAKYEQPGGYRPAPVDLSQVLLSSEHQEVVNLLAENDHNVWARERIAQGWTYGTQQ
DVKAKRSPYLVPYSFLDEKTRRLSRDSVREVVGTLLAFGYSLDPHSLKQATLANQCLFSA
EKCRVFRPDKSHAVSRGKWYFEFEAVTAGKMRVGWARPSCSPSRELGSDDRAFVFDGFEA
QWYHQGAEPLGRSWQRGDVVGCLVDMDESTMMITLNGELLFDARGSELAAKDFDISDGLL
PVASLGVNQVGRLNLGRCAASLQYFTVCGQQEGYQPFAVNMARDPALWISWQQPQFSSIR
PDDHIQVTRASGSVGSLSSLRVSQRLFAHYNGSSQISFFRLSMHIECASVLISPAGGVLP
VASSSLSPGRREQEEVDPDFEVLRKSALTFAGSRDELNHKDHNQEKTTRMKHRWSSLTTN
VVVFDERHPYIDSSFFFSFLLKRNKPGLVSSNSSARLLEDVVFDKENCDHLIQSSRYYYS
ARVLPGQEPFNVWVGWVTSNFHSHDATFDPDGVHTVTVTLGDDSGKVQESIKRRVCYMVC
AGEATGLAQSRRSSGLEIGCLIDTATGLLTFTSNGVEMSTFFQVEACTKLFPAVFVRPTT
TCMFQFEFGCIKNAMPLSAGLLRSQRCNVTPHCPPRIQVQQLKPGSWTRLPSQAVKVVVD
QPDAYGGWTIQCSEALQVMNLQIPDENRCVDILELSELDDLLTFHLHTLRLYCSLCSLGN
TRVSHAICSYLDTSQFLHAIQNPHLPGLLRSVFYQLLIQVHLSSHTTACLMMNHEYIIPM
AAKAGDTTLYPSSFTGHNGGNGITNSSHCTSLKPQMHFSSPSFVSNYALEGNYTAERNHG
DSPEFPLDLLKNLTIQMLTEAVTALCQEVRDPVGGTIELLLVPLIKLAYSLLVMGVLEDE
DLGKVLRLLDSEVSFTNSQSSMDEEKEDEKDDEKEHSLHHHQKDSHPKIGLLQIKLPEAV
KLELCHLLSYLCDCQMRQRVEAVAAFSDTFVCQLQENQRFRYNEVMQALNMSAALTARKT
KEFRSPPREQINMLLSFRDDEVSCPCPVQIQELLHNFHHLFKTHCGIESESDGEDEEAAE
SVRTQILSQVAKVIGIKKKPLEVDASKPVASKTLKHLVSKTLVHWSQEKMQDPELVRAVF
SLLHCQYQGLGGQMAGPLSRTYTISHTSVDDTMALLSSLSQIRSLLCVRMGKEEEKLMIR
KLGDIINNKVFYQHPDLMRTLGMHETVMEVMVNVLGEGESKEIAFPKMVASCCRFLCYFC
RISQHNQGALFDHLSYLLENASVGLASPSMRGATPLDVAAASVMDNNELALALTESNLQK
VIHYLASCGLKSCPMLVAKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENAYMVLRLL
IRRPECFGPALQGDGGNGLLAAVREAIRISDDPSMDGPSGPHQSTRSIDVIQDNDDDLIH
MGHAMVTFYSALIDLLGRCAPEMHLIEGGKGEALRVRAILRSLVPVHDLEGVISSSFCLP
SVTKDGGVVEPDLSAVFCPDHKAAMVLFLDRVYGIQNQSFFLHLIEVGFLPDLQAAVSLD
TVDLASTDMALALNRYLCASVLPLLSKCSALFCDLEDHVLLVDSLIQAIYSLSHALSLTK
AQRDTIEDCLLALCSKLQPSLMQPLLRRLVFDVPHLPEHNKLALKLLTSHYEQRWKYYSM
VGEPGDHSLASEEELHLSRKLFWSVFKDLNKKPYEPQLFRLCVQCLAAVAKALPPDHTDA
GCTSAMEGKASADEQFDPQPIDTSNVSVPERLEFIVNKYAEHTHEKWSLDKFANGWVHGE
QLCESSKVHPLLKPYRTLAEKEKEAYRCAIKETIKTMLAFGWSIERTKEADAHSVHTCAR
RVSQSGQQLSFEGTSTFSPKPTDVSTITLSWDQCAMAEQLAENYHSTWAKRKKLELQGRG
GGGHSMVVPYDALTAREKTKFRERAQDVLKFLHLNGYTVWRDRRTVEMDFPAVANCFGST
LLMQFLSHTENTQEHMLEMEVMQARGQTSKGERTQLRQPVQVFHKVILPLLEEYVRTHCL
YFLSSMSLSGKRGHASNKEKEMIASLFCKLAALIRHRMSLFGNEASAVSNCLCTLAQALD
ARTLMNSASESVRSSLDSFFESSAADLEMTVENLCVSVARLSQSRSQHARGVARVLSYTS
VVLLPTLTSLFQHLGLQNYGGDLLVGTIQVSCYKILNSLYSLGTTSSIYMEGQRPAAGAC
LAALAATFPVCFLEPDLNQNNPYSIYNTASALEKEELGLPDHAGDMCPLLPSLEQALGDV
KQLAAAGAGARQSQYIHVTEVVLPMLCSYMSLWWSWGPEGQPNSPLCTTVTPQHASDLLG
HVLRIIHNHVGTSQADWMKRMAVHCLSITCHAHPELLKTHFLPLMEKLKKRAEGVLLEEE
RMKADAGDSSEAELEIQQKFMVLVADLYAFYPLLIPFVDSNRARWLKESTPEAEQLFIMV
AEVFTFWAKSHNFKWEEQNYVVQNEINSLLFLVKSNKLSKFFNFQLNHEKRKVKKKGDRY
STHTSLVVASLKRLLPVGLRNCLLSDRSLITLAKNGFTQKDTEDEIRQHIFSAFTLLQTQ
DHSFLNDEVNDAERGGQRGKTADVQKAVDRVLNMGRVLCYLDQVEHPQRNRKTARHKILS
KQRKRAVVACLRMAPLYNLPRHRAVNLFLQGYNKTWISTEDHSFEEKLVEDLALSGGVAE
NDTVDGIKAIDPLLQLITLFSQTALMESSKLENGRLYQSYAAIMAKSCQRDDDGDGKEQE
LESFEEKELEKQKLLFRQARLHRRGASEMVLQIISASRGLMGSVIAPTLKLGIALLSGGN
AAVQQKMLVYLRERRDVGFFQSMAGLMLSCSVLDLSAFERQNKAEGLGMAMDESSGPLFS
PADKVMPDKDVTCDLFRFLQLLCEGHNSEFQNYLRTQAGNNTTVNIVISTVDYLLRLQES
VSDFFWYYSGKAAIDVHGQHNFSKAIEVSKQVFNTLTEYIQGPCAGNQESLAHSRLWDAV
IGFLHVFAHMQMKLPQDSRQIDLLKELLDLQKDMVVFLLSMLEGNIVNGTIGKQMVDMLV
ESSGNVQMILRFFDMFLKLKDFTSSDAFQAYDPDFKGCVSRKDFQKAMEGCKRFSQAETH
FLMSCMGPDDREKVDYEAFVDGFHEPAQDIGFSIAVLLTNLSEHMPNDSRLRTFLEVAES
VLTYFQPFLGRIEILGSGKRIERVYFGISASSRTQWEKPQVKESKRQFVFDVVNESGDKE
KMEMFVNFCEDTIFEMQLAAQLSGSGVEERHVEASPEEKGDTNGLDNKGIGVMCQWLVLT
SVLSVKALMKMSVKDVLVSAVVFLKFVLMAQFRCVLIVVRSIWYVLHRAFLSGELIEGAK
RARISEMLGGILEPTLDEVMGGPRGTRLRKGSSSLTLQKELSGSRLAQTMASTRDMHVLS
DIFGLTVKKEGSGYRLISKDLTDSLTDLFTPACRGATCLDHFCAILTLFSEPQTHIHQEE
KTEEKGADGKQNKSDQNSEAILKDPKWRAQRLNPKSKEAENQPSALWEMVSTHNKSMLNY
FARNFYNLRVLALFVAFAINFILLFYKVASSPAAQVEEKEMPSAYSAGDDAEEGTVCFVL
EERSGYMEPSLRFLAVAHTIISFFCIFGYYCLKVPLVIFKREKEVARKLEFDGLYVTKQP
PEEDIKGQWDRLVVNTPSFPSNYWDKFVKRKVMDKYGEFYGCEKISDLLGLDQAALDCSS
ERKGRKRLRRSTVWSHLFSSIDVKYQVWKTGVVFTDNSFLYLAWYMAMSVLGHYNNFFFA
AHLLDVAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVLAFNFFRKFYNKSEDKD
ARDMKCNDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEFEVERIVFDITFFFFVIVILLA
IIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSEYFDKVPHGFETHTLQEHNLANYLF
FLMYLINKDETEYTGQESYVWKMYQERSWEFFPVGDCFRKQYEGQLG
Download sequence
Identical sequences H3BY57
99883.ENSTNIP00000000922 ENSTNIP00000000922 ENSTNIP00000000922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]