SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3BY98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BY98
Domain Number 1 Region: 900-1026,1222-1350
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.02e-41
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 2 Region: 502-584
Classification Level Classification E-value
Superfamily E set domains 4.67e-17
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.03
Further Details:      
 
Domain Number 3 Region: 584-688
Classification Level Classification E-value
Superfamily E set domains 3.06e-16
Family Other IPT/TIG domains 0.038
Further Details:      
 
Domain Number 4 Region: 399-496
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000071
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 5 Region: 52-103
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000249
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 6 Region: 8-55
Classification Level Classification E-value
Superfamily Sema domain 0.0000000222
Family Sema domain 0.018
Further Details:      
 
Domain Number 7 Region: 704-762
Classification Level Classification E-value
Superfamily E set domains 0.0000392
Family E-set domains of sugar-utilizing enzymes 0.066
Further Details:      
 
Domain Number 8 Region: 351-386
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000994
Family Plexin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3BY98
Sequence length 1351
Comment (tr|H3BY98|H3BY98_TETNG) Plexin A4 {ECO:0000313|Ensembl:ENSTNIP00000000963} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
IRVDGSSLALQYETVQAVDNGPILRDMAFSSDYHYLYVMSETQLSRVPVEACGQYSSCSE
CLGSGDPHCGWCVLHNTCTRKEKCERSLEPRRFASDIRQCVRLSVHPNISVSQFSVTLVL
EAHNVPELSAGVNCTFEDLAEMNGLVEGNRIRCSSPAEKEMPRIIVDKEDHQIVQLYLKS
KETGLVFANTTFVFYNCSVHKSCLSCVSSPYQCHNFCSYETRHLCCWQGCHCAVVTGLLT
LHQGCPQLLPADRILVPVNVVKPITLRAKNLPQPQSGQRGYECLLTIQGNEHRVPALRFN
SSSVQCQNTSYFYDGMEMSSLPVELTVIWNGDFTIDNPTHNKVHLYKCDAQRGSCGLCLK
ADPLFGCVWCKGENRCTLKQHCPHPENQWLEHNGINSKCTHPRITKITPLRGPREGGTLV
TIRGENLGLDFREIQGNVKVAEVDCTPIREGYIPAEQIVCEMGKAEKSQYTGNVQVCVGV
GECRPEFMAKSSKYYYFVIPRIINLKPSRGPVSGGTIVNITGSHLDAGSNVSVMFKDQPC
TYLRRGGQWLTCRTHASLHGYGNVSVSVSIDKAHLQKDLRFEYVEDPTITKIEPEWSIYS
GHTAVTVTGTNLDIIQTPLIRAKYNNHETLNLCQVLSPTSMLCQAPELPISLARQQEVLE
KPDEFGFKLDDVQSLMALNNTNFIYYPNPEFELLSVTGVLELKPGSPIILKGRNFLPPTS
SGNGRLNYTVLIGEKPCMLTVSETQLLCESPNLTGRHKVLVSAPGLNFPPGVVHITSDSP
LSSTAIISIAAAGAMLILVIVVVLIAYKRKSRESDLTLKRLQMQMDNLESRVALECKEAF
AELQTDIHELTSDLDGAGIPFLDYRTYTMRVLFPGIEEHPVLRDLEVPGYRQEQVEKGLK
LFGQLINNKVYLLCFIRTLEAQRGFSMRDRGNVASLIMTVLQSKLEYATDVLKHLLSDLI
DRNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFSLFCAIKQQMEKGP
IDSITGEARYSLSEDKLIRQQIDYKTLVVNCIHPENEKSPEIQVKVLNCDTISQVKEKIL
DAIYKNIPHSHRLKASDMDLEWRQGRGQRMILQDEDITTKIEADWKRLNMLSHYQVPDNA
VMALVPKQVTAYNSVNNSTVSRTSASKYENMIKYSGSPDSLRSRTPMITPDLESGVKVWH
LVKNHEHGDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAI
KYMFDFLDEQADKHNIHDPHVRHTWKSNCLPLRFWVNVIKNRSITDACLSVVAQTFMDSC
STSEHRLGKDSPSNKLLYAKDIPSYKSWVER
Download sequence
Identical sequences H3BY98
ENSTNIP00000000963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]