SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BYK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BYK8
Domain Number 1 Region: 364-550
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 4.32e-80
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.0000000391
Further Details:      
 
Domain Number 2 Region: 31-124
Classification Level Classification E-value
Superfamily A heparin-binding domain 5.36e-44
Family A heparin-binding domain 0.0000024
Further Details:      
 
Domain Number 3 Region: 125-189
Classification Level Classification E-value
Superfamily Amyloid beta a4 protein copper binding domain (domain 2) 3.66e-30
Family Amyloid beta a4 protein copper binding domain (domain 2) 0.0000175
Further Details:      
 
Domain Number 4 Region: 294-351
Classification Level Classification E-value
Superfamily BPTI-like 9.36e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3BYK8
Sequence length 750
Comment (tr|H3BYK8|H3BYK8_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000001074} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MGEMRAFVLLLAATLTLSSEVPADDTVGLLTEPQVAMFCGKLNMHINVQNGKWESDPSGT
KSCIGTKEGILQYCQEVYPELQITNVVEANQPISIQNWCKKGRKQCRSHTHIVVPYRCLV
GEFVSDALLVPDKCKFLHQERMNQCESHLHWHTVAKESCGERSMNLHDYGMLLPCGIDRF
RGVEFVCCPAETERETDTSEIEGGESDVWWGGAEPEYSDSSMPRTADAGPANTPENEDVA
EDAFERDETGDDEDEEDDDDDDVDVTDEQESDERGASVAMTTTTTTTTESVEEVVRAVCW
APAESGPCHAMLERWYFSPEKRRCVPFLFGGCGGNRNNFESEEYCLAVCSSSLPTVAPSP
PDAVDQYLEAPGDDNEHADFKKAKESLEAKHRDRMSQVMREWEEAEHQAKNLPRADKKAV
IQHFQEKVEALEQEAAGERQQLVETHMARVEALLNSRRRLALENYLGALQASPPRARQVL
SLLKKYVRAEQKDRQHTLKHYEHVRTVDPKKAAQIRPQVLTHLRVIDERMNQSLALLYKV
PSVASEIQNQDVIVQKVQSELSQQVSSLQSEGQLDGLVSYGNDALMPDQAYSSAPMDTGL
DGLGFVHPESFNQANTENHVEPVDARPVPDRGLPTRPVSALKPEEMPQVRMETDERQSAG
YEVYHEKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLRKKQYTSIHHGVIEVDA
AVTPEERHLARMQQNGYENPTYKFFEQMQN
Download sequence
Identical sequences H3BYK8
ENSTNIP00000001074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]