SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BYQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BYQ6
Domain Number 1 Region: 50-280
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.49e-58
Family Ankyrin repeat 0.0000000452
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3BYQ6
Sequence length 990
Comment (tr|H3BYQ6|H3BYQ6_TETNG) Zmp:0000001167 {ECO:0000313|Ensembl:ENSTNIP00000001122} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
SRSEAAKQRRQDQLQRWLGSETDRTGSEARDTLSASGTRRAKVRFAQGAVFMAACSAGDR
EEVAALLRQGADINHANIDGLTALHQACIDENAEMVQFLVESGSDINRGDNEGWTPLHAA
ASCGFIQIVKFLIEHGAHVGAVNSEGELPLDVATEDAMERLLKEEIKKQGIDVDKARKEE
ERVMLQEATAVLAGGGTLLPHPNTKATALHVASAKGYIEVLKVLLRCGVDVNSRDVDGWT
PLHAAAHWGQEEVCGLLADSMCDMGAVNNVGQTPLDVADENLADALEELQKKQNALRSEK
EKQTPVIDTSQQIPIVPVRARRSSKEKICLHEREKHPSPALPSGPVEDEEEEGQTGQGQP
QSQGKASSSSSSEEESESESDAESEKAKNRELINNLNNKRNTSGLLPTSMSLSSAVSQMK
KVKEVGHQASLRATKDLTKPPTGEAPGSWRTSLRKAGSSVTLGSAELTDSSQEQSRVPDP
GLGMTRSASSPRLSSEAEAKVNAVSSEPRLARVPPIPTRRLFSIPDSSPESSNSPSWLSR
SSSYTRRLPSQPGNDFTSSTPSLLHSSSYGKRLDDPSVTSANTGTSASGLGHLNSVLSQS
DSEPRLLLPGQSSFLNKANAFFSSYLKTSFSPRLPQEQKDPSAVTSANSQAPTAGEQETK
QRRKSYLTPVRDEEAEAQRKARSRHARQSRRSTQGVTLTDLPYVPLIGLHSSHVTSLSRR
TWCLQEVSWRSRIASLQKSDLLGLTQPSGSSRPPAADKKGAHLPLKEDFSAYNSPLTCLI
FTDAEASTGENEMERWARERRERRQARARRKAQRTGEFLCRVQSDDNEPSGEEEFSGSGL
DPRVRTAAAFALFVFPSFFTHSVSRSDSVISDLCSYSSCNDCTPGGETKDFKKLFEEVSR
ENSQLQSQLQDTQRVVSQTRLELEKATQRQERLSDCSALLELERKDRRMLERRLGELEEE
LKVLVDLRADNQRLKDENGALIRVISKLSK
Download sequence
Identical sequences H3BYQ6
ENSTNIP00000001122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]