SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BZM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BZM2
Domain Number 1 Region: 45-234
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.95e-43
Family Ankyrin repeat 0.00031
Further Details:      
 
Domain Number 2 Region: 272-331
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000227
Family SAM (sterile alpha motif) domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3BZM2
Sequence length 457
Comment (tr|H3BZM2|H3BZM2_TETNG) Ankyrin repeat, SAM and basic leucine zipper domain containing 1 {ECO:0000313|Ensembl:ENSTNIP00000001438} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
RIMDRTFPAGEENEDSGDEWDIGISYEKTSFVQQDLDAVASGKDDVMLKRAITNGDTETV
RQLLDKGLDVEMRLDFGWTPMCAVSVADYNVAELLLERGADASFHKADGWSVLMACITAS
AQEDRITRCVELLLSRNADPNVADRSQMTCLMLAAKRGHAKVINLLMVFGAEINAQDSYG
YTALSIAVQHRRQEAVLKLLQLGADKTIRTNTGKCPADLAAIFKNTEMSKILASSQPISA
SQASSSMENTLSQFFATSGEVSSAKECGRKLDELQLLLHGLDLGSLTDIMAKNDITWSHL
LSMDKEDLEEIGVTDPGDQQKVLDALRQMNLGKVDLETIDRFGGADSGSEELCNFLTIQD
VIGRIPCHPSKIAFALDPEKEAQTLCNQLVIQTGDLQKEVTCLRKLLCQLDHEECCQPPP
PEPCGPWGRQVLSGAALGVLGATCLLVLYGATSGCFT
Download sequence
Identical sequences H3BZM2
ENSTNIP00000001438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]