SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BZS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BZS2
Domain Number 1 Region: 893-1182
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 7.26e-83
Family Complement components 0.0000162
Further Details:      
 
Domain Number 2 Region: 1268-1396
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 3.01e-26
Family Alpha-macroglobulin receptor domain 0.001
Further Details:      
 
Weak hits

Sequence:  H3BZS2
Domain Number - Region: 731-785
Classification Level Classification E-value
Superfamily E set domains 0.000154
Family SVA-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3BZS2
Sequence length 1430
Comment (tr|H3BZS2|H3BZS2_TETNG) CD109 molecule {ECO:0000313|Ensembl:ENSTNIP00000001488} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
VCGGVILTLLFCFCSQEHPASYLLLAPGSLQPGLQTTLSVTILGSSPVLVSAGITHQNQM
VAMNSVTVEGAWELKGFCFPGATQLLTLPAIQRDESSHRSPYLLHVKGHVNEVEVFSNET
ELTFDPKCFSTFIQTDKPNYRPGQAVRMRVVSLGPDGRPNHSPVNVTVRDPRGNLLRQWL
AVDGVHGVVSKEFQLSENPPVGQWSIVARVSDAVTEKHFSVAKDASPTFSVHIQAPKRVH
RDQVLQGSVQAKYVYGKPVRGHVNLTFIYPPRWRLTSTFLSLLQIDGTADFTFDLLGYRH
VEKSHLGMAFYDGNVDDESVTVLVHVTDQLTGLTCNSRTTVFVATSRYDLCFEGHPKMLK
PSLSFVAMLKVSTYNKQPLSLEDRQKPVRVSVKQQKQQGWMEGVEEKEEEMVAEEMELHV
PADGIIPLSITLKNDTGILLIEAYFGDSHHSLQLYRGYSSPSHSYLQIQRPPTPAQVGSP
VTLNIQSNFPVFQIRYLVKAGGQVVSAGAGAAPLSLLPEASWAPLACVLVYCLHPTGEVV
NDQIELPVTPVTNNKVSLSWSRSVVEPGDQVVLRVTAEEPASLVGVLVVDKATQRGGSHN
DLTLDSMLHKPELLDAYPIFQMGDPYSVFKTCDLVAMTDAMLQVPEHLLYLDALAEEELL
HHQDEGSAMEEDEHLQEHFPETWIWKDVHTGHSVSSDIQVTVPDSLTTWVVSAFVVSENL
GLGFAEAPVELTVLKDFFLSLNLPACVIRGEELLLEVVVFNYLPHQVEVTVTVAESHMFQ
FVFSDQGGLATPFVTHLFVESQGEASVHIPIRPLVLGEVPVSVEAKTSTASDSMVRTVVV
KAEGLEQFFSSSLLLELSSQSSLAEHLSFSFPPDVVMGSQRASVTVVGDLLGPSISGLDH
LIRMPHGCGEQNMINFAPNVYVLQYLSATGQADPETTARATAYMSTGYEQELTYQRADGS
FSAFGDSDAAGSTWLSAFVLRCFLQARPFIGVDAQVLEGVAAWLSTQQGAGGRFEESGRV
IHTELKGGLEGPVSLTAYVLIALMEDPDLSVSGALGFLETRLDLGISSNYSLSLVAYALA
LANSSRAPLALQELMGRAELKDGVPLWSSPEAGRSRSSWQPRSADIEMASYVLLSHHKLG
LIAEGVKLMKWLSQQRNDRGGFRGTQDTVVALQALATLAALTSSHDIDLTVRVNTDEWVA
AAVFHVDQDNYLLHQSQQIEAGEGLHLQVTAEGWGLALFQLNVFYNVWRVEPTRKRRDSQ
EPGAEPEAFRLSVELFDSDSHPAHLSICLSLVQGLALSATGMAIVEAGLLSGFVLPPDGI
QTDDVVRKVETPPGKVIVYLDSVTTSEVCLSIPLMVQNKVAKVQEASVLVYDYYESTRRA
TQTYNSGRRREQTSSDLCGQLEGHCPGSVFDSGVRLSGVWPALLLILLFL
Download sequence
Identical sequences H3BZS2
99883.ENSTNIP00000001488 ENSTNIP00000001488 ENSTNIP00000001488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]