SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BZU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BZU7
Domain Number 1 Region: 949-1236
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 4.85e-84
Family Complement components 0.0000364
Further Details:      
 
Domain Number 2 Region: 777-897
Classification Level Classification E-value
Superfamily E set domains 1.68e-34
Family SVA-like 0.012
Further Details:      
 
Domain Number 3 Region: 1297-1432
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 6.54e-33
Family Alpha-macroglobulin receptor domain 0.00019
Further Details:      
 
Weak hits

Sequence:  H3BZU7
Domain Number - Region: 365-427
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0251
Family Invasin/intimin cell-adhesion fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3BZU7
Sequence length 1436
Comment (tr|H3BZU7|H3BZU7_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000001513} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MWALFLCLNWIFTDGAAAGPQFMVAIPAVMEAGAESRLCISLLQPNETLAVTAKLVFEDK
ATVIFERSSDKEFHQCAVFQAPEVETPEVHALLVTVRGDQFHSVESRKVMFKSYKPETFV
QTDKPIYLPGQTVHFRVVTLDSMFRPANGLFHTIKILDSHQNRIGQWLNATTDGDILQLS
FPLSAEAREGYYSISVWMEQSQVTRRFKVEKYVLPKFEVTIEMADQVSVGQEEIDVDVCA
KYTYGQPVPATVTVEMCRKLRSSSDTLIQVPCFEEEKKVPKYPKWMSEYTDKRGCAKFTP
SMSTFTKIDSKVLQRTLFLTAKVQEEGTGTLFSKQKRVELSFIIGKLFFVDTPNSYNEGS
MLEGKIKVVHYNDTPIADKQIQLLNDKSWQGHVLQNLTTDADGIATFSLNTTLFNGEEIQ
LRVRGLRWATKPKFESAHHRASLYQPPSPHSKSVSSLTVSNTETPLLCEGDETLSIDYAF
VGETAGTVNLMYLIVSRGKIVTQGVQTVQILTDPTTEGSISFTLKMSPEFSPALQVVAYT
ILPSEHVIAHKADLAVTKCFLNKVSVEFSPTSAVPGDDTTLKVKALPDSLCGVSAIDQSV
LVKEPGNTLTPEQIFNMLPVRKVSSIPYEVEDAVPCLRVRQKRYIGRRRRPDDVNDAYSV
FEGIGLKVATNLLFRMPSSMSTAETSDSRRGFSSVYRESVPYIMAMKQKGTGAAPGGGVI
ETIRTFFPETWVWKLVKVGESGETDVALTVPDTITTWETEAFCVSPQGFGLAPRKEITVF
QPFFLELSLPYSIVRGEQFELKATVFNYQTSCMMVSVKTAKSEDYTLTPLSANEYTSCLC
GNERKTLSWTMLPSVIGVVSVTVTAEAVASHASCDNEIVSVPERGRTDTVTRSLIVKAEG
TEMTKIHNWLLCPKEEPLKEEVELDLPANVIDGSARALVSVLGDILGRALKNLDGLLRMP
YGCGEQNMALLAPNIYILQYLKSTGQLTDTILKKATHFLTSGYQRQLNYKHSNGAFSTFG
TGSGNTWLTAFVVRSFAKAKTFVYIDEAKMDSKNWLLLRQNPGGCFQQYGKLFNNRMKGG
VSDEVTLSAYTMAAFLEMGMSPTDPAIHRSMLCLKDSVSNLNNTYTTALLAYVFSLAGDM
KTRDFLLQHLDTVASGQGSLLYWSQSAEDQSSSLSVEISSYVLLAKLSSSPTAEDLGYAS
RIVRWLTGQQNYYGGFSSTQDTVVALQALALYSTLVFSPAGSSTVTVQAPSGQLVFDVNQ
DNKLLYQEKTLQDLKGTISLEAAGSMCASIQISLHYNIPTPTDTNIFSISVKPECSSEKN
RVTLQLMSQYSGKDITTNMVILDVKMLSGFVPDPESVKSLRGALFVDRVEEKEERVLVYI
GELLKDIPIIHTLSLTQVVPVENLKPALVRVYDYYQPSDQAETEYIFPCAAEYPTL
Download sequence
Identical sequences H3BZU7
ENSTNIP00000001513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]