SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C049 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C049
Domain Number 1 Region: 7-91
Classification Level Classification E-value
Superfamily Integrin domains 9.94e-27
Family Integrin domains 0.0022
Further Details:      
 
Domain Number 2 Region: 251-330
Classification Level Classification E-value
Superfamily Integrin beta tail domain 4.45e-16
Family Integrin beta tail domain 0.0026
Further Details:      
 
Domain Number 3 Region: 168-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000137
Family Integrin beta EGF-like domains 0.0046
Further Details:      
 
Domain Number 4 Region: 135-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000363
Family Integrin beta EGF-like domains 0.017
Further Details:      
 
Domain Number 5 Region: 210-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000865
Family Integrin beta EGF-like domains 0.014
Further Details:      
 
Weak hits

Sequence:  H3C049
Domain Number - Region: 97-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00446
Family Integrin beta EGF-like domains 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3C049
Sequence length 393
Comment (tr|H3C049|H3C049_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000001615} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
QKLSSKVTLTHDRLPKDVQILYTPDCQAAGQPGPSEGVCDNVKEKQEIAFNVTVVANSCM
KDQSFTVRVLGIKDTLTVTVSTNCECDCRDTQDSQQQACSGRGSLKCGVCSCNDGFIGQS
CECSIGNKDEQTLRDSCRRDKGVECEGRGDCVCGRCHCHGSYHGDFCQCDDEHCERFQNK
LCGGNGKCSCGQCRCNEGYEGSACQCKVSQEACQTPNNTVCYGRGKCTCSRCECNDGYQR
PHCKTCLGCPDPCQTKLKCIECLGFNSGPFKANCSDACGSVTKVDRFTGESKQCELKDSE
GCWIKFSLEQIVGPDDYYARIQSERVCPEPLNTNAIIGGSIALVALIGILVLMVIKLLIW
MNDRKEYKKFEKEQKKAKWNDGDNPLFQDATTT
Download sequence
Identical sequences H3C049
99883.ENSTNIP00000001615 ENSTNIP00000001615 ENSTNIP00000001615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]