SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C080 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C080
Domain Number 1 Region: 479-628
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-40
Family SPRY domain 0.00021
Further Details:      
 
Domain Number 2 Region: 6-82
Classification Level Classification E-value
Superfamily RING/U-box 2.78e-16
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 143-204
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000519
Family B-box zinc-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3C080
Sequence length 633
Comment (tr|H3C080|H3C080_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000001646} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
LNPVKPLATELSCPICFQLFSDPVVLPCGHNYCRTCIWMTACSADQSDQTPLCCPECREK
IRDVDSLQKNFKLCNIVEGFRAVNAQFEGHFQTKPEQTEVFCDQCVDEPSLAVRSCLNCE
VSLCSRHFQKHQEKETFRLHSLVEPLSELGKKNCVIHHRPLEYFCSNDMNLLCATCFIEG
HHQNHDILTFSAAEEEMRRALQMRSQVVLVFGVLTKLKKKNIDVSVTVTFVYNQLKRPWE
HNLLVQMSNKFIVLLQMTESLLQNMAEEQGASDVIGDKTVKKATSLIDSIAARVERIHIK
PHRDEFFFLLQSAHIFNLQAKPFYLFSFLTVGLILLCRSPRTSLKHKNTWYRERLHEVLE
EERSHCRKSWQLTLSFLEQQQHYLTDAHKMAHANAHREGHDQQVRPSRGWHSGAGVSTVP
SHQDVSGFESHAEVSILFSNARTHIHTNTKNFTFLKTFLLHPQASLKTQDFRSEMTHLLR
TVKYTHNKQLYPEHPERFTSAPQILCSKGFSGGEHVWVVDIGPNTMWSMGLCYKSIPRRG
DHSRLGHNSVSWRLQWKNSKLTVCQSSCNVALREVKTHPQRVEIALDYEGGTLMFHSTGG
HREHLYTFRAVFREPVYPAFSIHSNTTESWISL
Download sequence
Identical sequences H3C080
ENSTNIP00000001646 99883.ENSTNIP00000001646 ENSTNIP00000001646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]