SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C0A6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C0A6
Domain Number 1 Region: 6-287
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.46e-83
Family FCH domain 0.000000000938
Further Details:      
 
Domain Number 2 Region: 558-615
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000236
Family SH3-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3C0A6
Sequence length 623
Comment (tr|H3C0A6|H3C0A6_TETNG) Formin binding protein 1b {ECO:0000313|Ensembl:ENSTNIP00000001672} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
VIFSPILQDQFDNLEKHTQWGIEYLEKYTKFVKERSEIELNYAKQIRNLSKKYQPKKNSR
EEEESKYTFCRAFLATLNELNDYAGQHEVIAENLVSQIITELVRYTQDLKAERKSHFHDG
RKAQQHIESSWKQLESCKKKFERDCKEADRANQYFEKLDADINVTKADVEKARQQAQMRQ
QMAADSKNDYSSYLQKFNQEQNEHYFTNIPAIFQKLQDMEEKRIEKLGVCMKTFAEVDRQ
VLPIVGKCLDGMTKAAESIEPKTDSKQVVESYKSGFEPPGDVEFEDYGQAMKRTASETSL
SNSKDGKEKSGSKSKGKLWPFIKNKNKINVLIVVPCEGPPALSASSLPSPSAVPNDSQSP
KQHKEPLSNRLNDFMASKPKMHCLRSLRRGLSLKLGSGPEDFSHLPPEQRRKKLQGKLDD
INKDIQKEMDQRDALTKMKDVYIKNPQMGDPASVDPRLSEIGQNIEKLQFEAQKFEGWLA
EVEERMPSKSDTHRRSVLYEAQNSTTVGNNCAQDRESPDGSYTEEQNSETQVKAIVNPTS
TTPDFDDEFDDEESLPTIGTCKALYPFEGHNEGTIAMAEGELLYVIEEDKGDGWTRVRRN
QDEEGYVPTSYVEVFLETNAKGA
Download sequence
Identical sequences H3C0A6
ENSTNIP00000005003 99883.ENSTNIP00000001672 ENSTNIP00000001672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]