SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C0B5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C0B5
Domain Number 1 Region: 30-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-38
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 145-255
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-36
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 3 Region: 258-372
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-33
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3C0B5
Sequence length 376
Comment (tr|H3C0B5|H3C0B5_TETNG) CUB domain containing protein 2 {ECO:0000313|Ensembl:ENSTNIP00000001681} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
AMGLRVAALIYLLLLVDKADSKKDHKGFKCGGILSAPSSNISSPNFPSPYPYNSDCSWLI
VVAEGSSVHLTFHHFELEYHASCSYDYIKIYNGVAEDEGNLLGMFCGDVSPPQFTSSWNV
MSIIFHSDRHVAYRGFSVGYRKDMCGGVLTGLSGEISSPGYPLEYNNNADCTWTIRVSSA
SVVTLVFLDFQLENNEGCNFDFVALFDGPTVAHRHLGNYCGAAKPPHVVTTSNNLLVVFK
SDFNIGGRGFKAYYYSGECQQVLSAVSGTFSSPRFPNIYPNNINCHWGITQAAGYRVKLF
FPFMDLEDQNSLSGECDYDSVTVYDGDSQTDAVLGRWCGRERPPSLISRSNKLLVVLRTD
RNGAYRGFTAAYLGGK
Download sequence
Identical sequences H3C0B5
99883.ENSTNIP00000001681 ENSTNIP00000004012 ENSTNIP00000001681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]