SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C0S0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C0S0
Domain Number 1 Region: 7-234
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.07e-68
Family Ankyrin repeat 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3C0S0
Sequence length 563
Comment (tr|H3C0S0|H3C0S0_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000001836} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
QGARCTEVDNDGRIPLILAAQEGHYDCVHILLENKSCIDQRGYDGRNGLRVAALEGHRDI
VELLLSHGADIDYKDADGRPTLYILALENQLAMTEYFLENGANVEASDTEGRTALHVSCW
QGHIEMVRLLINYHADVNACDNEKRSALQSAAWQGHTKVVQFLIENGTHVDHTCNQGATA
LGIAAQEGHIDVVQILLENGADPNHADQFGRTAMRVAAKGGHSMIIKLLEKYGATTLNGC
NPSPVHTMEQKTPLAVTGKMQSLTIKSSSSGSTGAGDIQSSVRGLPNGPVHAFSSPSESP
DSTVDRQKSSLSNNSLKSSKNSSLRTTSSTATAQTVPIDSFHGLTFTEQIQQHSLPRSRS
RQSIVSPSSTTKSISQQPASPANDFDWSQLKPVHKSTNGSKIGNGTSNSKGASGDKKKCK
NTASSQGQVLEYEMKQFDKRIALNKSVANIAVKDPHYKIMIGGSVRADRVQAQEPFQEQF
FIQQQSCSEKKRNGIMTNPNYHLQGNQVFLSRVSMPRSAQNRGHQDVLENYPIGETELSL
KQALKLQIDGSDPGFNYKKETPL
Download sequence
Identical sequences H3C0S0
ENSTNIP00000001836 99883.ENSTNIP00000001836 ENSTNIP00000001836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]