SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C0T2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C0T2
Domain Number 1 Region: 274-443
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-46
Family SPRY domain 0.00016
Further Details:      
 
Domain Number 2 Region: 12-81
Classification Level Classification E-value
Superfamily RING/U-box 6.48e-19
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 3 Region: 89-139
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000519
Family B-box zinc-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3C0T2
Sequence length 453
Comment (tr|H3C0T2|H3C0T2_TETNG) Tripartite motif containing 35-28 {ECO:0000313|Ensembl:ENSTNIP00000001848} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MAESMEQDVSEELFHQEMTCSVCRDIFKDPWVLPCSHSFCQECLQGSVNPRGRRCPLCRE
SFVEGRAVPNRVLSDICRAYKTYPLPGIQKPDGEAVCKLHMKPLELYCEKDEQPVCVECV
TMHNTHTLWPLKDAVPLCALEQKIQIFERKVTSYQTLTQNLDNTVDYIKNQASEAEKQIQ
VEFKKLRDALLTEERLRLSELAQEEEQKIAAVQKLTKNVNQDISDLKKLIVSVKKEIGNE
DLRLLQKVAFIIKIALVSVSEFPGFEKKFFPHWISNPVVFDPNTASPWLSLDADLTAVKE
SHEPLITPDNPERFDPCGFVLGAEGYTSGKHRWDVMVRDCPSWVVGVCKEAVARKKKFTL
SPSRGVWCIGLSKGVCTAFTNERMALQVQQRLERIRIKLDMDKGEVSFWDGESATHLVTL
QHNFNVKIFPFFGPGVHSTSMILVPGKITMHTS
Download sequence
Identical sequences H3C0T2
ENSTNIP00000001848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]