SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C0Y1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C0Y1
Domain Number 1 Region: 823-877
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000114
Family Laminin-type module 0.00016
Further Details:      
 
Domain Number 2 Region: 930-980
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000271
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 3 Region: 283-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000126
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 4 Region: 719-770
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000201
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 5 Region: 879-927
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000698
Family Laminin-type module 0.00071
Further Details:      
 
Domain Number 6 Region: 439-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000446
Family Laminin-type module 0.0061
Further Details:      
 
Domain Number 7 Region: 392-441
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000363
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 8 Region: 768-825
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000113
Family Laminin-type module 0.00052
Further Details:      
 
Domain Number 9 Region: 978-1023
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000265
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 10 Region: 1038-1260
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000425
Family Tropomyosin 0.0022
Further Details:      
 
Weak hits

Sequence:  H3C0Y1
Domain Number - Region: 94-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00119
Family Galactose-binding domain 0.04
Further Details:      
 
Domain Number - Region: 682-721
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00248
Family EGF-type module 0.055
Further Details:      
 
Domain Number - Region: 337-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00753
Family Laminin-type module 0.033
Further Details:      
 
Domain Number - Region: 1275-1533
Classification Level Classification E-value
Superfamily Tropomyosin 0.0392
Family Tropomyosin 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3C0Y1
Sequence length 1604
Comment (tr|H3C0Y1|H3C0Y1_TETNG) Laminin, gamma 1 {ECO:0000313|Ensembl:ENSTNIP00000001897} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
RSINRPASGRVRRARWACLVRGGAAQKPGCIRAAMDECADDRGNPQRCMPEFVNAAFNVT
VAATNTCGSPPEEYCVQTGATGVTKSCHICDARDPRNHHSAAYLTDYNNQQDTTWWQSQT
MLAGIQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRSSQDGPWVPYQYYSGSC
EKTYQKVNRGFIRTGEDEQQAVCTDDFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQD
WVTATDIRVTLNRLNFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKDAGRLV
CNCKHNTKGDDCGVCKPFYNDRPWRRATENANECLPCSCNGKSSECFFDGELYRATGHGG
HCRNADNTDGPNCERCRENHHRDLNGERCLACGCSAVGSESLQCDSRGVCTCKPGVTGDK
CDRCQPGFHSLTEAGCRPCACSPSGSTQECDVNTGQCRCKDNVEGFSCDRCKLGYFNLDP
QNPLGCTACFCFHHSSVCESADGFSVHTITSSFQRADNERWTAQQRDGSSVAVQWSPSKQ
EVFLTSEDYFPLYFLAPDKFLGNQMLSYGQNLSLSFRVDRRDTRLSAEDLVLEGAGMRVA
VPLIAQGNAYPNENMHTYVFRLHDSSDYPWRPTVSHADFQKLLHNLTAIMIRGTYSERSA
GYLDDVSLVTARRAPGVAARWVEQCTCPQGYQGQHCERCTVGYRRTRPELGAFSACEPCS
CNGHSDSCNPDTGACDCQDNTAGLSCERCRDGFYGDASGGTAADCHPCPCPAGATCAVVL
RSKEVVCTNCPAGTTGKRCELCDDGFFGDPLGQSGPIRTCRACKCSENIDPNAVGNCDRE
TGKCLKCIYNTEGSFCDRCKNGFYGNPLASNPADKCKPCSCSPLGTVGGQSSCSQVTGQC
PCHPNVAGRDCGACQPGFFNLQSGTGCARCDCDPVGSTNGQCDIITGQCECQPGVAGLRC
QRCELDFFGFSSSGCKPCDCDPEGSAAAQCQEDGRCQCRPGFVGTRCDMCEENFFYNRSV
PGCQQCPSCYSLVRDKVNQQRQKLHELQTLIDNLSSGQDQVSDQAFEDRLQEAEKAILEL
LEEAQSSKDVDRALLERLNSINNTLTTQWNRLQNIQNTVDDTSNRAEQAQNRVQDAKSLI
ERAQRELDRAQEAVSKVDIRPPSSAADPNNMTLLAEEARALADRHKMEADQIEKIAKDAN
DTSTRASKLLLKTLDGEAKTSQEIDQLNRKYNEAKDLAKNLEKQASKVQAEAQEAGDEAL
KIFANLTSLPPFNTDALEEDASKIKKEAADLDKLIDKTEKDYSELRDDLKGKEQEVRKLL
EKGKSEQQTADQLLARADAAKALAEEAAKKGQSTFREAESILEDLRDFDKRVSDNKTAAE
EAMKKIPHINATIQAANEKTRQAEAELGNAAADALEAKTKAEEAQRIASNVQKASTKTKE
DAERAFLDTSKLDGEVGDMMDQLTAAEQELARKKAEADQDMMMASMASDNAKEAENNARK
AKSAVKMVLNTITVLLDQLGNIDRVDLSKLNEIDESLKNAKGKMADSDLDRKLAELNDMA
RSQEDMIVDYDRQIQEIHADIANLNDIKNTLPDGCFNTPSLERP
Download sequence
Identical sequences H3C0Y1
ENSTNIP00000001897 ENSTNIP00000001897 99883.ENSTNIP00000001897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]