SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C137 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C137
Domain Number 1 Region: 399-565
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-49
Family SPRY domain 0.00031
Further Details:      
 
Domain Number 2 Region: 134-197
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000259
Family B-box zinc-binding domain 0.00075
Further Details:      
 
Domain Number 3 Region: 3-53
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000139
Family RING finger domain, C3HC4 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3C137
Sequence length 570
Comment (tr|H3C137|H3C137_TETNG) FinTRIM family, member 99 {ECO:0000313|Ensembl:ENSTNIP00000001953} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
SSFPLPPELYCPLCADTLRDAVTIPCGDTYCLDCIKIYWDQFDHTGVYSCPQCHATFTPR
PVPRHSPPDVNQEPRRQLPELAPFPYMHRESYCDFCVGRRSKAVKSCLVCLAYYCEAHVK
PHYESSTFKRHKLVDETGHLDRKICPHHEKGLELFCRSDQMCICVLCTVREHRGHNIASA
EEERIEKQKILVVTQSEVQYIIQERMKELQELKHNVDVLKSGAQRAQAESEKTFHEMLQA
AERWKAEINQMIVSNMQAAMSQADGYVERLEQEIMELQRRDAELRQILETEDNIHFLQNF
PTLCVPPEAMVPKVLINPQFSFGEMSKTAVDMKEHLDDICKKELSKISKTVNETPVYILL
PRNGDKRHKGRRRAEVRLVPSRADLQEPKTRSDFLRYACRMTFDPNTAYKELVLSEGNQK
VTRKKTVHFYPDHPERFDGFSQLLCKEPLSGFRFYWEAEWSGEFSIGVAYRSISRKGKNS
HSLLGYNDRSWSLLCSDSGYSVWHSKVDRDLPNAPRATRIGVYLDYAGSTLAFYAVKETM
ELIHKFKAQFSEPLYAGFGVGSSVTLCQLR
Download sequence
Identical sequences H3C137
ENSTNIP00000017144 99883.ENSTNIP00000001953 ENSTNIP00000001953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]