SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C1C3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H3C1C3
Domain Number - Region: 16-118
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0534
Family Filamentous hemagglutinin FhaB, secretion domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3C1C3
Sequence length 311
Comment (tr|H3C1C3|H3C1C3_TETNG) Nuclear transcription factor Y, alpha, like {ECO:0000313|Ensembl:ENSTNIP00000002039} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MEQYTTATTTTGEQIVVQTANGQIQQQVQGQPLMVQVSGGQLITSSGQPIMVQAMSGSQG
QTIMQVPVSGAQGLQQQIQLVQPGQIQLQGGQTLQLQGQQGQPQQIIIQQPQTAITAGQN
QGQQISVQGQQVAQTADGQTIVYQPVNADGTVLQQGMITIPAASLAGAQIVQAGGTSTNT
TNSNQGTVTVTLPVSGNMVNAGGMVMMVPGGGAVPTMQRIPLPGAEMLEEEPLYVNAKQY
HRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMQRKRGDGGRFYSPKEKEEALLLAQ
ELFSISKVDLN
Download sequence
Identical sequences H3C1C3
ENSTNIP00000002039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]