SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C1J3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C1J3
Domain Number 1 Region: 572-632
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000162
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 28-75
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000115
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 501-546
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.00091
Further Details:      
 
Domain Number 4 Region: 626-683
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000175
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 5 Region: 81-118
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000116
Family LDL receptor-like module 0.0016
Further Details:      
 
Weak hits

Sequence:  H3C1J3
Domain Number - Region: 452-490
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000533
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3C1J3
Sequence length 844
Comment (tr|H3C1J3|H3C1J3_TETNG) Complement component 7a {ECO:0000313|Ensembl:ENSTNIP00000002109} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
LSVVTPFLLFLFISKGKNEMFVLCNLGINCQWGPYGDWSECDGCTKSQTRSRVVAVYAQF
GGNSCPGGRTETRPCETTRGCPLEDGCGGRFRCRSGKCISQSLVCNGDQDCEGDGLDEHC
PSDRFIICTQSTLPPNVELLGLGFDVVSEQTRASVINTKSFGGQCRTIYSGVHQTIYRLP
VSTLQYSFMVKVQNDFSDEMFSSKWHYAKSIVQRERASGTTTGYRNYDFRETEDRTRVRS
SYRKPQMQKLLVLKNEIEVAQFQSNSPQYIPLSEELWKALVKLPSVYDYAAYRKVLERFG
THYLSEGSLGGTFKVVAKIDEETQRYMRTESSEYNECEETKYWILFFSFTRKTCRSGSSN
SRFSTGTRSGNHLSRVDVVGGGVQHSAALSTMSLDDPNKNWEMYSNWADSVRSFPQVTKQ
KLRPLSELVKEVQCAGVKKMYLRRAIEQYLSESDPCHCQPCRNNGLVFTDGNTCKCVCKP
GTSGLACEQGTEIEGQQGVIQGSWACWSTWSSCNGARRSRSRSCSNPAPQNGGQYCSGES
TETSDCDEDELSYLKTMEPQCFDQTLPESHKCETPPPLINGYIMEPKDIYLVGSKVEYTC
ISGFHLGSSTIECTENKTWSSRPGLCIRSACQLGSLAEGVMAYPINGAYSIGDTVTLSCP
EGRQLLGESEITCDPSLNFSPDPASISCSPVKRQQTLLPPEVQCQPGKKPSKGKCVCKMP
FECRSSLEVCTTVAVTNRPFLLTVCKMHALRCLGKRYLIAEDGVCEWPQRNTTGCTNCHL
WELCDDQTNECRCKDSADCSDPGVNVCVRVGADGQNQTMSECEAGLKRCKGEQVSVVSIL
PCTG
Download sequence
Identical sequences H3C1J3
ENSTNIP00000002109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]