SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C283 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C283
Domain Number 1 Region: 411-553
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.86e-21
Family MAM domain 0.0023
Further Details:      
 
Domain Number 2 Region: 98-213
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000011
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 3 Region: 215-263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000103
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  H3C283
Domain Number - Region: 30-68
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0259
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3C283
Sequence length 553
Comment (tr|H3C283|H3C283_TETNG) Nephronectin {ECO:0000313|Ensembl:ENSTNIP00000002351} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
RWPRQMAASNGLCRYGARVDCCWGWTRRSWGHCQPLCQPGCKHGECVGPNKCKCHPGFTG
KTCNQEDAPDYPPPHLWAARFPLFRTVDHQPASRVMEDLNECGLKPRPCKHRCMNTYGSY
KCYCLNGYMLLPDGTCGNARTCGLANCQYGCEVLKGEVRCQCPSPGLQLAADGRTCVDVD
ECATGIAVCPRFRKCVNTFGSYVCKCHEGFDLQYINGKYQCLDVDECSLGRSHCSSYATC
YNTPGSYKCKCRDGFGGMGHDCKPIPRVIIDPPRPGKIPPNHHNHIPDSKSTTAIMTTTA
KTTTAKMTTMSPATTRVPPLTKKVTPPTRRPEVVTWKPFVPTPTRKPYIPPPPPPPVTPV
DNSIQKEVTKQRGDVHIPRNHDRNTVLDIDFDIELGNTADESKDDPESGFLSCSFDDGLC
SWIRNNNGDVHWETTPDPSGGRYLTIPEVGNKRTGRGAQLVLPLTPPWNDGNLCLSFRHK
LAGHHVGMLQVFVKKGKQYSPAVWGRTGGNGWRHTQITLWGTGLESVILKGERSRGRMGE
MAVDDIALRKGAC
Download sequence
Identical sequences H3C283
ENSTNIP00000002351 99883.ENSTNIP00000002351 ENSTNIP00000002351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]