SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C298 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C298
Domain Number 1 Region: 1229-1270,1345-1508
Classification Level Classification E-value
Superfamily NHL repeat 0.0000000000575
Family NHL repeat 0.0098
Further Details:      
 
Domain Number 2 Region: 636-661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000477
Family EGF-type module 0.04
Further Details:      
 
Weak hits

Sequence:  H3C298
Domain Number - Region: 766-791
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000151
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 736-760
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000921
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 669-694
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00134
Family Integrin beta EGF-like domains 0.086
Further Details:      
 
Domain Number - Region: 602-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00368
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 803-837
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00576
Family EGF-type module 0.088
Further Details:      
 
Domain Number - Region: 703-729
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0762
Family Integrin beta EGF-like domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3C298
Sequence length 2764
Comment (tr|H3C298|H3C298_TETNG) Teneurin transmembrane protein 4 {ECO:0000313|Ensembl:ENSTNIP00000002366} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MEVKERRPYRSLTARQDTEHRYTSSSADSEDGKANPKSYSSSETLKAFDHDSRMAYGSRV
KEMVHHEVDEFSRQGVDFSLRNLGFGEALPSHVATYRSDMGLPHRDYSVSAGSDPDTETD
GIMSPEHAVRLWGRSNTKSGRSSCLSSRANSNLTLTDTEHENTENVKSHEGAFQNHSRLR
TPPLPLSHSHSPSHQHHAASINSLNRSNYTQRSNPSPAPTDSSVPPEGPASQDSVSVQDN
WLLNSNIPLETRNIAKQSFLETLQDNLIEMDILASSGRDASYNDGQFLFKPGGTSPMYCT
TSPGYPLTSSTVYSPPPRPLPRNTFSRPAFSLKKPYKHCNWKCAALSAILISVMLLFLLA
YFIAMHLFGLNWHLQPVQRQMYQLSEDNTSGLPFPTDLSVSPVGNTGLVIPERRGKDTVE
SKLDSLFPDDSYIDMGEIDVGRKVTQQIPPGVFWRSQVFIDHPMYVKFNVSLSKDALVGI
YGRRGLPPSHTQQFDFVELLDGRRLLVQDIRGVEGPAAMQRGLIPITTHDTGFIQYMDSG
IWHLAIYNDGKETETVSFLTTATDSIDDCPSNCFMNGDCIAGKCHCFLGFKGPDCGRAAC
PVLCSGNGQYLKGRCMCHSGWKGSECDVPTNQCIDIACSNHGTCIVGTCICNPGYKGENC
EEVDCMDPTCSGRGVCVQGECHCFVGWGGSGCESPRASCMDQCSGHGAFLADTGTCSCDP
NWTGHDCSTEICAADCGGHGVCVSGSCRCDDGWMGSGCDQRACHPRCNEHGTCKDGKCEC
SPGWNGEHCTIAHYLDKVVKEGCPGLCNGNGRCTLGNNGWYCVCQLGWRGTGCDTSMETA
CTDVKDNDGDGLVDCMDPDCCLQATCHTTALCVGSPDPLDIIQETQLSSTQSKLQTFYER
VRFLVGRDSTHVIPGVNPFDGKHCCFPLMSIPNTGAVFVSTSWVEHKLSGYSCPATDGSF
DLVTNGGIAVALHFERAPFITQEHTLWLPWGRFFVMDTIVMRHEENDIPSCDVSSFSRPS
PLVSPASLTAFAGSCSERRSVVPEIQEEESANTQESDMKFSYLSSRTAGYKSLLRVTLTH
STIPFNLMKVHLMVAVEGRLFRKWFPAAPNLSYDFVWDKADVYSQKVYGLSEVFVSVGFE
YESCPDFILWEKRAAVLQGYETTASKLGGWTVDKHHALNIQSGILHMGNGENVFISQQPP
VIGSVMGNGRRRSISCPSCNGLADGNKLLAPVALACGSDGSLYVGDFNYVRRIFTTGNVT
SVLELRNKDFRPIGKKHSIYLNKYRKSVKVAAVDGHVTQLIRILLIVPCVSEVSCSEIVI
GFAHPCLLLNTWWCQNGEHSLKQASVLSAGITVDKYGVIFFVDGTMIRRIDQNGIISTLL
GFNDLTSARPLSCDAVMDISQVRLEWPTDLAVSPLDNSLYVLDNNVVLQISENHQVRIVA
GRPIHCQVPGIDHFIMSKVAIHATLESANALAVSHTGILYIAESDEKKINRVRQVSTNGE
IFLVAGAPSGCDCGQELAVMTYHGSSGLLATKTNENGWTTFYDTIGSYSVPRLSDAVFNL
SRSPSPVFELESVAFLKVSEVSGELHLFVVPAKKVYNDALPPGVRLFSVEVKANGKTLFT
VLDSDMHNRIRTELFPLQNFDIMEAARQAAPLKKTFSSVLKARTKSNVAFTHFHSGTLAV
KNIRGIGSFVMYDSYGRLTNVTYPTGQVSSYRTDADSSVRIQTEGSNKENITVTTNLSAS
GTFYTLMQDQVRNSYFIGLDGSLRLVLANGMEVSLHTEPHLLAGTIIPTVSKRNITLAID
NGLNLVEWRQRKEQARGQVTVYGRRLRVHNRNLLSLDFDRITRTEKVYDDHRKFTLRIHY
DHAGRPTLWAPSSRLNGVNVTYSPGGNVAGIQRGTMSVRMEYDQTGRITSQIFADGKSWT
YTYLEKSMVLLLYSQRQYIFEFDKNDRLSSVTMPNVARHTLETSRSIGYYRTTYQPPEGN
ASVLQDYSEEGQLLQTTYLGTGRRVTYKYGKIAKLLEMLYDTTRIGFYYDELTGMLKTVN
LQSEGFTCTVRYRQIGPLIDRQIFRFSEEGMVNARLDYVYDNSFRVTSMQAVINETPLPI
DLYRYDDVSGKTEQFGKFGVIYYDINQIITTAVMTHTKHFDAYGRVKEVQYEIFRSLMYW
MMVQYDNMGRVVAKELKVGPYANTTRYTYEYDADGQLQVVSINDKPLWRYSYDLNGNLHL
LSPGNSARLTPLRYDNRDRITRLGDVQYRMDEDGFLKQRGNDYFEYNSAGLLVRVYNKVS
GWSIQYRYDGLGRRVSSRSSIGHHLQFFYADLSSPTRITHMYNHSSSEIASLYYDLQGHL
FAMELSSGDEFYVACDNIGTPLAVFSGAGIMIKQILHTAFGEVYLDTNPSFQLIIGYQGG
LYEPLSRLVHMGKRDYDVLAGRWTTPNLEIWKRLNSKHIAPFNMYMFKNNNPLSNNEEIK
CYMTDVNSWLVTFGFQLYNVIPGYHKPNTESMEPSYELVRTQIKTQEWDSTKSLLGVQCE
VQRQLKAFVKLERFGQIYGAKSAGCPQTETKHIFATMGSIFGKGVKFAIREGRVSTDIIS
LANEDGRRMAAVLNDAFYLEHLHFTVAGMDTHYFVKMGPVEGDLSLIGMTVGQRTLETGV
NVTVSQVNAVLNGRTRRITDIQLQYGTLYLNTRYGSSVDEEKARILEMARQRAVTQAWAR
ERQRLRDGEEGSRTWTEGEKQQLLGSGKVQGYDGYYVVSVDQYPELADSVNNIHFMRQTE
MGRR
Download sequence
Identical sequences H3C298
ENSTNIP00000002366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]