SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C2G2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C2G2
Domain Number 1 Region: 75-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000134
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 2 Region: 24-72
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000474
Family Laminin-type module 0.00098
Further Details:      
 
Domain Number 3 Region: 123-168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family Laminin-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3C2G2
Sequence length 183
Comment (tr|H3C2G2|H3C2G2_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000002430} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MPGAHGGPPLRTLPAGTGKNDKPCSCNPVGTSGDVNECHPQTGHCRCLSHVTGRDCGSCE
VGFFNLQPGVGCERCQCNPIGSSSLACHPVTGQCVCRAGVEGRLCDSCRMGFFGFSSRGC
RACNCDPMGSLSMQCHNNGTCRCRQGFVGYNCDKCELNYFQSRATHQCEECPVCYSLVKK
QVS
Download sequence
Identical sequences H3C2G2
99883.ENSTNIP00000002430 ENSTNIP00000002430 ENSTNIP00000002430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]