SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C2J0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C2J0
Domain Number 1 Region: 178-297
Classification Level Classification E-value
Superfamily Cap-Gly domain 3.93e-38
Family Cap-Gly domain 0.00000312
Further Details:      
 
Domain Number 2 Region: 44-133
Classification Level Classification E-value
Superfamily Cap-Gly domain 2.62e-33
Family Cap-Gly domain 0.0000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3C2J0
Sequence length 1355
Comment (tr|H3C2J0|H3C2J0_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000002458} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
KASGLKPPSKIARPSGAPAKTSPSSGAPKPVPPDKPPGGATSPTQEGGADFQVGDKVWVN
GNKPGHVQFIGGTQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEDGRGIFTRPSKLSKS
ALPEKDMNGTQAGPPPPAPGEPAPAAASTGNANTHHRGFQRGRASSRCQVSGIKTIAALN
QMSTESASNLSDPESQKRTRRELRLGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEP
LGKNDGAVAGTRYFQCMPRYGLFAPVHKVTRIGFPCTTPTKTKSSQRRSLLKRSPSASSM
SSLSSANSSFSGKPSRAGLLAETSARYARKISGTTALQEALKEKQQHIEQLLAERDLERC
EVAKATSHAGAVQQELLLMRKGRDQYAIEMEAKLDQLRSLVEAADRDKVELLNQLEEEKR
KVEDLQFRVEEACITKGDLETRDSDETQTQTRLEHAHIKELEQSLLFEKTKAEKLQRDLE
DTRVATVSERSRIMELEREVADLQLRLRASQQKEDAASLSQQQISCLKAQAQTREKKISE
LSVDVESKQKELQSLQHDKSCLEEQLLNLKQKLENAEEESRRMAKTTRGKRLSRTLSPPL
LCQTGGLSELEQSVELTRKDCQLLKEENLCRQKELKQIISVRACVTSVVDESACFLAQPL
AFLYQAVSSYLTCMKQRQGVVSRTTVGCFRLELSASCFCFMVLVTNSPQADCNFPLLRCI
SGTLLQSSFHRSKLVFQVTETSEKMALTVEQLSSDRRMLETQVSSRIQGDTPLSGLDRTL
DTIFPCYSSVGYRWNLAASVTSACSCHRILVDLLIPSFVSEGLHAKDGLVLILADNIGKA
KAGILSAFANVLVVEGRWEELIPAYIMEVLRESGTPLRRRSPHLPLTDKDASPLKLESFL
RLYLRWPPFLVLAQLETLKEQNSKHQEELSLSQERSSSENQRVGLLCKKTRHPSPLKVSQ
IIQLVGTLLRTPPQSVQANKNPSGSLRLLRQASEIHQYFSRDGLNVRWQTVEEIIHALNS
EGGEAGGRERFRSSLPRASSRRRSSVEPLALALQQRAPPSSPGHLLPPSAPVIEDIAASK
SFRIASEHKQNSGLMKDLGRRGGEDHLTGDVQERGNKSSGDGCAVNMIVHVRGWNATSDQ
EMESPTGFQRSTGALISAKDRELETLRNEIEVLRGENAVAKTLQSAVETLERDKAQLQGR
VHSLEQRLAGRRASEDQAGAPPSGGAVLEQLREEKEFAEGQINFLNSVIVDLQRKNEELK
IKLKKLALAEFNGNEESDGLGGVSKQEKKATPRLFCDICDCFDLHDTEDCPTQAQSPDSV
PHTAYHGNPADQRPYCDICEAFGHATESCNDDQTF
Download sequence
Identical sequences H3C2J0
99883.ENSTNIP00000002458 ENSTNIP00000002458 ENSTNIP00000002458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]