SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C300 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C300
Domain Number 1 Region: 5-148
Classification Level Classification E-value
Superfamily E set domains 5.46e-19
Family Arrestin/Vps26-like 0.028
Further Details:      
 
Weak hits

Sequence:  H3C300
Domain Number - Region: 148-188
Classification Level Classification E-value
Superfamily E set domains 0.00259
Family Arrestin/Vps26-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3C300
Sequence length 190
Comment (tr|H3C300|H3C300_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000002618} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
XPEVDRPPVFSSGDVVSGRVLLDLFGEVRVSSLKLHAEFAKVHWTERSAGSSTAYTQNYS
DEVEYLNRREVLLQADNGEVSVLAGRHEFPFSFQLPEETLVTSFEGKHGSIRYWVKVKLH
PRATVKKIKKDFTVIEPIDINTPALLAPQAGTKDKLARAWYRNFGQVSVTAKIDRKGYTP
GEVIPVFAEF
Download sequence
Identical sequences H3C300
99883.ENSTNIP00000002618 ENSTNIP00000002618 ENSTNIP00000002618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]