SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C327 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C327
Domain Number 1 Region: 379-567
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 1.31e-77
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.000000027
Further Details:      
 
Domain Number 2 Region: 30-124
Classification Level Classification E-value
Superfamily A heparin-binding domain 3.14e-44
Family A heparin-binding domain 0.00000254
Further Details:      
 
Domain Number 3 Region: 125-189
Classification Level Classification E-value
Superfamily Amyloid beta a4 protein copper binding domain (domain 2) 1.7e-29
Family Amyloid beta a4 protein copper binding domain (domain 2) 0.0000193
Further Details:      
 
Domain Number 4 Region: 286-348
Classification Level Classification E-value
Superfamily BPTI-like 7.38e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3C327
Sequence length 770
Comment (tr|H3C327|H3C327_TETNG) Amyloid beta (A4) precursor protein a {ECO:0000313|Ensembl:ENSTNIP00000002645} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
LLPSANLLLCRIYAAHGLLQVPTDVSMGLLAEPQVAMFCGKINMHINVQSGKWEPDPSGT
KSCIGTKEGILQYCQEVYPELQITNVVEANQPVSIQNWCKKGRKQCRSHMHIVVPYRCLV
GEFVSDALLVPDKCKFLHQERMNQCESHLHWHTVAKESCGDRAMNLHDYGMLLPCGIDRF
RGVEFVCCPAEAERDMDSTEKDADDSDVWWGGAENDYSDNSMVREPEPAEQQEETRPSDV
DEIDAFGESDDVDADEPTTNVAIPFKKISIDNLPQELLLLCYNSECVYVVLQDVCWANAE
TGPCRALLPRWYFDREEGRCAQFIYGGCGGNRNNFESEEYCLSVCSSVLVHALRHTPPTA
INFSPTTVPTAMPSSPDAVDHYLETPADENEHAHFQKAKESLEAKHRERMSQVMREWEEA
EREARNLPRADKKIVIQQRFQEKVEALEQEAASERQQLVETHMARVEALLNDRRRLALES
YLTALQQDPPRPRHVFSLLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRPQVLTHLR
VIEERMNQSLGLLYKVPGVADDIQDQVAPPELLQREQAEMAQQLANLQTDVRVSYGNDAL
MPDQELGDAQADLLPQEDTLGGVGFIHPESFNQLNTENQVEPVDSRPTFERGVPTRPVTG
KSMEAVPELRMETEDRQSTEYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL
VMLRKKQYTSIHHGIIEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Download sequence
Identical sequences H3C327
ENSTNIP00000017561 99883.ENSTNIP00000002645 ENSTNIP00000002645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]