SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C3A7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C3A7
Domain Number 1 Region: 28-221
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.02e-37
Family Laminin G-like module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3C3A7
Sequence length 876
Comment (tr|H3C3A7|H3C3A7_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000002726} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
RPRYKLDFNRLDGDSVCPPLRSGQDDLPGFDLITQFQLDVIPLKGVRKVDGSTSLQVAYR
LDREANFQIPTMLNFPRGFPDEYSFMVTFRMIKNTVNKVWNVWQIMDEEGNKQAGLRLNG
DQQALEYFLIDADGNLQTVTFPGLSVLFNTRWHKVMIGVERNQVTLYVDCQPVDMRPIRG
KGPINTEGDTLIGRLDTDPDASVVFELQWMLIHCDPKRAQRESCNELPATEANSHASSCE
PEKAVQGPPGPPGPEGPRGSAGENGRDGRDGLPGPPGSPGIPGSKGEAGELGLPGQRGLA
GLPGPPGSSGPMGPRGPVGERGLPGFPGPPGPPGPPGKPGIPGDEGNIGPEGPPGPRGTA
GIAGPPGPPGPPGPVCPAACPAGPQGLPGIPGMKGHKGLAGEPDQDGKPGEKGVAGAEGP
QGPPGRMGDDGQRGPVGFPGSAGEKGDRGPPGFNGVPGPTGPPGAPGVEGTRGRQGLEGP
KGDDGAVGPQGEQGPKGDKGDVGEPGADGLHGIPGADGAKGEAGTPGALGIRGIVGIPGL
PGKPGAAGPSGAQGEPGADGPTGPVGLPGKAGEPGKPGEDGKPGDKGATGETGKQGPVGP
AGPPGIVGERGDKGDTGAKGMKGHTGLKGDQGPMGPIGPKGSQGDQGETGDIGVKGDQGP
PGVPGIKGESGEKGNRGSTGETGQPGQPGHEGLAGPAGARGLEGEPGPPGSPGPRGLPGP
KVNDENLREICSAVVEEQLAEFMKELLKKPAAIGAPGTPGPAGLPGPPGAAGEAGAAGPP
GPAGPKGHPGFFGIPGAPGQKGDPGVKGDKGDNGENGVGIKGSAGAPGAPGAPGTPGVGK
DGQKGERGETGVPGIPGASGPRGPSGPPGLCDPSTC
Download sequence
Identical sequences H3C3A7
ENSTNIP00000002726 99883.ENSTNIP00000002726 ENSTNIP00000017027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]