SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C3E8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C3E8
Domain Number 1 Region: 138-390
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.4e-56
Family Ankyrin repeat 0.00015
Further Details:      
 
Domain Number 2 Region: 424-739
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.33e-40
Family Patatin 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3C3E8
Sequence length 752
Comment (tr|H3C3E8|H3C3E8_TETNG) Phospholipase A2, group VI (cytosolic, calcium-independent) {ECO:0000313|Ensembl:ENSTNIP00000002767} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MQFLGRLLDTVSSNLFANPYRVRDVPLSDYAGGGKIKLREEGRMVLYKNNQCRSWDCLLM
CPEMPMSTLRLFQVASEEDAMNWFPHYALTLQPFYEMLPLKAETTQPIVDCIRSHPDWSS
AHVAIDTGLRECLKHNYVQSQINSRDAAGQTPLHLACERGDPVCVKELLEESQAQTDIKD
RSGQTPMHMAAKHDSPAVIQVMCSRMCSGVNELNNSGETPLHVACRLGRVESVKALLAGG
AKCDIIGGAGYPIHSAMKYSEKCCVEEVLKADSGQLHAEDSAYGGTPLHWAKTAEMCRVL
LEHGCEINYLSKTGESPLHIMTKKGRFEAAMVLLTHGANANLKGQDGNTALHLAMKLDHI
ELIKALIVFGADVEIHNDLGETPGLIAARTSKGFEDIIYMGAAVAAMSRGSSQVDGCKMQ
KNRMDRLLCLDGGGIKGLVLIQMLIALEKEAGRPTRELFDWVAGTSTGGILALAIIHGKS
MEYLRCLYFRMKEQVFKGSRPYESAPLEEFLKKEFGENTKMTDIRYPRVMVTSVLADRHP
GELHIFRNYDPPSVHREAPYATTATFKPLTIPQEQLVWRAARSSGAPTYFRPMGRFLDGG
LLANNPTLDAMSEIHQYNKALKAEGREKETKKLGVVVSLGTGKPPQVAVSSVDVFRPSNP
LELAKSFVGAKELGKMLVDCCTDSDGCAVDRATAWCEMIDTVYYRLSPQLSQEVLLDEVS
DAALVDMMWETQMYLYEKRESLQSLAKLLLNN
Download sequence
Identical sequences H3C3E8
ENSTNIP00000002767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]