SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3C3I5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C3I5
Domain Number 1 Region: 231-518
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.31e-87
Family Complement components 0.0000112
Further Details:      
 
Domain Number 2 Region: 56-154
Classification Level Classification E-value
Superfamily E set domains 0.000000000714
Family SVA-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3C3I5
Sequence length 578
Comment (tr|H3C3I5|H3C3I5_TETNG) C3 and PZP-like, alpha-2-macroglobulin domain containing 8 {ECO:0000313|Ensembl:ENSTNIP00000002804} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
RTFFPETWVWHCLNVSSETGQAELRLDVPDSITTWVTEAVGLSEEKGLGLARRAELRTFK
PFFVDFTLPYSLIRGEQTKVPLTVYNYLPTCAEVSPRTLGVVASKQGQRKKCVPPGEATP
TSIVFSVTELGPANITARAIAYSEPSCCSDEFQAAKSSNDVEERRTAIGMDYVRRTVLVE
PEGLPREYTYSVFFCPNDENHNEAFTLGVPHNIVPGSERATAFMIGDVMGPTLNNLDKLL
RLPFGCGEQNMIHFAPNVFVLKYLQKTRQLSPDVENEATDYLLQGYQRQLTYKRQDGSYS
AFGERDSSGSMWLTAFVLKSFAQSRGFIFIDPEELRAAKSWLITHQQSDGSFPAMGRILN
KDLQGGIHGKISLTAYVLAALLETGIATEEEKVAVAKAKDFLESNTYSAEDPYTTALSAY
ALALLRSPYAPLALRRLNHMAITQGTATRTVSSPQPSVVSAEVEMTAYGLLTYTLLGDVA
SALPVVKWLSQQRNSLGGFLFSPQDTCVALQALSEYAILSYVGGVNLTISLASTNLDFQE
SFELNRDNKKLLQSARIPSIPTGLFVSAKGEGCCLMQV
Download sequence
Identical sequences H3C3I5
ENSTNIP00000002804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]