SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C3N7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C3N7
Domain Number 1 Region: 16-111
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.82e-20
Family Ankyrin repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3C3N7
Sequence length 206
Comment (tr|H3C3N7|H3C3N7_TETNG) Ankyrin repeat domain 24 {ECO:0000313|Ensembl:ENSTNIP00000002856} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
SQDWSKSDERLLQAVEQNESEKDGSTPLILAAQMSRAELCAFLLGRGANANIQDNEDGRS
ALMLACESDSIETVQVLLRGGAGTQLVDALGHKAADYSATAGNQRILQMLQHGPPPASGP
SAALSGKPGKSPKAEDEEVFEEIRRLRLERGRLLQKIKALEQQQQSALSALKELSQLKQR
LMEAEAERDQLLREYEELQERFSKAQ
Download sequence
Identical sequences H3C3N7
ENSTNIP00000002856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]