SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C475 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C475
Domain Number 1 Region: 274-466
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.29e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.000000125
Further Details:      
 
Domain Number 2 Region: 24-160
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-25
Family SH2 domain 0.00000027
Further Details:      
 
Domain Number 3 Region: 202-268
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.49e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000582
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3C475
Sequence length 466
Comment (tr|H3C475|H3C475_TETNG) Chimerin 2 {ECO:0000313|Ensembl:ENSTNIP00000003044} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MAASSNSSLSGSSLSSDPEDYQPPIWKSYLYQLQQESPRPKRITCPQEMESRPKYYGREF
HGRVSREYADELLAGAEGAYLIRESQRQPGTHTLALRFGHQTLNYRLFYDGKHFVGEKRF
ESVHDLVTDALITLYIETKAAEYIARMTTNPIYEHLGYTSLLKDKTVHRLSRGRTEPRRV
TFQRDDRRAAEIASPLVRRTVLKDAPEKQCSYEKIHNFKVHTFRGPHWCEYCANFMWGLI
AQGVRCSDCGLNVHKQCSKLVPSDCQPDLRRIKKVFSCDLTTLVKAHNATRPMVVDMCIQ
EIELRGMKSEGLYRVSGFSEHIEDVRLAFDRDGDKADISASAYADINIIAGALKLYLRDL
PIPVITFELYTKFIQAARIPNADTRLEAIHEGLLQLPPAHYETLRYLMAHLKRFCVLQGD
HDAETWDRLGPTLMQPPEMNALTSLNDMRLQKLVVQLMIEHEDVLF
Download sequence
Identical sequences H3C475
99883.ENSTNIP00000003044 ENSTNIP00000003044 ENSTNIP00000003044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]