SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C4B4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C4B4
Domain Number 1 Region: 833-913
Classification Level Classification E-value
Superfamily DEATH domain 1.92e-24
Family DEATH domain, DD 0.0000507
Further Details:      
 
Domain Number 2 Region: 129-221
Classification Level Classification E-value
Superfamily Immunoglobulin 5.77e-17
Family I set domains 0.024
Further Details:      
 
Domain Number 3 Region: 220-271
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000824
Family TSP-1 type 1 repeat 0.0005
Further Details:      
 
Domain Number 4 Region: 274-328
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.00065
Further Details:      
 
Domain Number 5 Region: 23-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000596
Family I set domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3C4B4
Sequence length 921
Comment (tr|H3C4B4|H3C4B4_TETNG) Unc-5 netrin receptor C {ECO:0000313|Ensembl:ENSTNIP00000003083} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=UNC5C OC=Tetraodon.
Sequence
DDDFIGLGDLPETFPSDPPEPLPVFLIEPEEAYIVKNKPVNLYCKATPATQIYFKCNSEW
VHQKEHTVEERVDENSGLVVREASIEITRQQVEELFGPEDFWCQCVAWSSAGTTKSRKAY
VRIAYLRKTFDQEPLGKEVSIEQEVLLQCRPPEGIPAAEVEWLKNEEVIDPADDRNFYIT
IDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSTWTEWSVCNSRCGRG
YQKRTRSCTNPAPLNGGAICEGQGIQKLACNPLCPVDGLWTEWSKWSTCGTECTHWRRRE
CSAPTPKNGGKDCEGMVLQSKNCTDGMCMQSSLYHKSSQAKDRSDFGNSLAPSTDDVALY
VGIVIAVIMCLVISVVVALFIYRKNHRDFDSDIIDTSALNGGFQPVSIKNARKADLLTAP
PDLTSAAAMYRGPVYALHDVADKIPMTNSPLLDPLPNLKIKVYNSSGLVTPQDDLAGEFS
SKLSPKLPHCLLDNGDSTMGRRAQTQTLLRTRDPSCTALGSFSSQGGQLIVPNSGVSLLI
PAGAIPQGRVYEMYVTVQRKDNMSLCTSRPSVEDGQTVLSPVVSCGPPGALLTRPVIITM
HHCAVCDGQQDWLIQLKSHSQPNQWEDVVVVGEENFTTPCYIQMDEEACHILTETLGTYC
LVGQSLSAATIKRLKLAIFGPVTCPAMEYHIRVYCLDDTQDALKEVLQMEKQMGGKLLDE
PKTLNFKDSTHNLRISIHDVPHTLWKNKLLAKYQELSFQHMWSGSQRNLHCCFTLERFST
STMDLACKICVRQVEGEGQIFQLDTMLSEDSQSIDTSLLDPASNITTLVGPNAFRIPVSI
RQKLCGSLDAPQTRGNDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQHFPDGNLSR
LAQVLEEMGRHDSLVPAVGEH
Download sequence
Identical sequences H3C4B4
ENSTNIP00000003083 99883.ENSTNIP00000003083 ENSTNIP00000003083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]