SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C4L9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C4L9
Domain Number 1 Region: 435-703
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.08e-74
Family Eukaryotic proteases 0.0000691
Further Details:      
 
Domain Number 2 Region: 27-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-31
Family Spermadhesin, CUB domain 0.0000681
Further Details:      
 
Domain Number 3 Region: 190-305
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.26e-22
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 4 Region: 309-379
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000025
Family Complement control module/SCR domain 0.00075
Further Details:      
 
Domain Number 5 Region: 376-446
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000375
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 6 Region: 137-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000297
Family EGF-type module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3C4L9
Sequence length 704
Comment (tr|H3C4L9|H3C4L9_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000003188} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MGWLSCVLGFLYVTVSLCWPLLEVEPEMYGEVKSPQYPKPYAPNLLEQWDLSVPEGFQIR
ITFTHLDIDASPGCHYDALTVYNGKKVLGKFCGSENSADGHHPGTEPLLSPGNTLTLVFK
SDSTNPERHQNVGFSAHYQAIDMDECAAEEPEDGSEPLCSQICLNTLGSYVCSCHHGFKL
QSDQRSCALSCNGGLFDEPKGHLASPGYPSLEQQALTCRYVISVPDGFTVSLNFSDSFHI
ESIDTKQGPECLHHWLQVSVPDQQPYKLCGDRSPGVIVTSSSSVTLDYHTDADGWSRGWS
LDYSTHRVQCPSPGSVAHARVTPTLNQYLYRDHIFVRCDTGYKLMMDGEELRSFSAMCQS
NGQWHLPLPECHIIDCGEPERLLNGGFEFVSGYQNQYQSVIKYHCNQPFYAPLGENEVSF
TCDADRSWRSINDLIVPPLCLPVCGQSLNPVSGHQRIIGGNVAQANSIPWQVLLSISGNR
AGGMVIADRWILTAAHVLTSGGSTVLANSVRIYMGLNTVEDPLPSHVNPTSIHIHPEYNN
PNLMDFNNDIALIKLQDPVTFSESVMPVCLPGDGSALVTGDIGVVSGFGITNEQKRRILT
NRLKYVSLPVVDQGKCNASVIEEKNKKPDTPSLTDNMFCAGLPEGGKDSCQGDSGSPFTI
SHDNRAWAAGIVSWGIECGRQGVYGVYTSVTKYLDWINKTMQEN
Download sequence
Identical sequences H3C4L9
ENSTNIP00000010858 ENSTNIP00000003188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]