SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C4T9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C4T9
Domain Number 1 Region: 6-92
Classification Level Classification E-value
Superfamily E set domains 8.26e-16
Family Other IPT/TIG domains 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3C4T9
Sequence length 927
Comment (tr|H3C4T9|H3C4T9_TETNG) Exocyst complex component 2 {ECO:0000313|Ensembl:ENSTNIP00000003258} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MSPARQPPLVTGISPKEGVAWTKVTIRGENLGTGPADLIGLSICGHNCLLTAEWMSASKI
VCRVGPAKDDKGEIIVTTKSGGLGTSTVSFKLLRPERIGILDQSAVWVDEMNYYDMRTNR
NKGISPLSLRPSNPLGIELDKGKIPQKDMELIFPGMSGDFTSENFSATWYLIENHSESSF
EQLKVAASNLKKQATKKNEGSLAYVKGGLSTFFEAQDALSAIHQRLESDGTERVGGSMTQ
RLENILNRASDTADTLFQEVLGRKDKADSTRNALNVLQRFKFLFNLPLNIERNIQKGDYD
VLINDYEKAKSLFCNTEVPFFNKVYSLVETRIQALRHLCYHRMLSSVCQVQCNICRYLSD
LHAPGDPAWQCICAQQKWILQLMQNCRDEFISGQRAEGHGMSVGALDLDGDTRPSALGRL
SHATSLKRGGSLRIPRSNTWHYETPQRVQFVEKLSDVVIGQLPNFWKLWISYVNGSLFSE
TGEKSGQVEKSKKNARQRQNDFKKMIEEMTHRLVKLVRGALLPTTLPKSEQNLYGGWDNK
TDLSGNWLTQIMHTVRACHEALSALEIPNDLLQVIQDLLLSLRVHCLMVTLEHTAEDVKT
LAEKEDWVVDNEGITSLPSQFEQCLVQMLQSLKEPLEVKPGEINVLQLERVQVQTTELIV
KILKVFINCLEQLSIRTDRDMDLSHDISVDLSSPDRFPGIQEGFSPTPEQRLLIILSNCQ
YLERRTILNLADHFEKHGFAGTEKITQISVEAVRQLDKNLFEAYVERRADPIAGSLEPGI
YAGYFDWRDCQTPTASGVRNYLKEALVTIITVHAEVFTVSQDLVPRVLSKIIESVADEMC
RLMQCVSSFSKNGALQARLEICALRDAVSTYLNPESIASFKLALDALPQLHSGADKKLLE
ELLNKFKSSMQLQLTCFRPCCVQPVKR
Download sequence
Identical sequences H3C4T9
ENSTNIP00000003258 ENSTNIP00000003258 99883.ENSTNIP00000003258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]