SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C5K2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C5K2
Domain Number 1 Region: 188-295
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-27
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 4-99
Classification Level Classification E-value
Superfamily Kringle-like 1.91e-26
Family Kringle modules 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3C5K2
Sequence length 427
Comment (tr|H3C5K2|H3C5K2_TETNG) Kringle containing transmembrane protein 1 {ECO:0000313|Ensembl:ENSTNIP00000003521} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
SVFSECYTANGEDYRGFQNQTSLHGGKPCLFWNETFQHPYNTLKYPNGEGGLGSHNYCRN
PDGDVQPWCYIADYEDGIYWRYCDIPTCQMPGNLGCYRDSGDPPTLSGTSETSNKLTIQN
CISFCRKQRYKLAGMESGYACFCGNEVDQGNRDESPSMECNHVCFGDHTQPCGGDGWVII
FDTRVGACGGNYSSPSGVIYSPDFPDKYSPGRVCYWTVQVPGSSAILFNFTFFDISDQTD
MVELLDGYTNQVVARFDWRSPPREAVNVTGDFVILYFYSDRTNQAQGFALLYQAFREVGV
ELPSSTAGPPMAGGLTEKPNSTSNERSSQIFYVITSSPGKPEHSMPVWTIYALSALLVLT
VIAMLAKLLLHITVKSPNIPTVSGSDSCSQSTASSEPWIILYRPSTISLFKKKLKNHHSD
LSPLVGN
Download sequence
Identical sequences H3C5K2
ENSTNIP00000003521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]