SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C6V3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C6V3
Domain Number 1 Region: 477-737
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.39e-91
Family Eukaryotic proteases 0.0000211
Further Details:      
 
Domain Number 2 Region: 226-334
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-23
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 3 Region: 339-373
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000249
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 126-221
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000144
Family Spermadhesin, CUB domain 0.0087
Further Details:      
 
Domain Number 5 Region: 450-489
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000107
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 415-446
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000602
Family LDL receptor-like module 0.0029
Further Details:      
 
Weak hits

Sequence:  H3C6V3
Domain Number - Region: 375-409
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0903
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3C6V3
Sequence length 738
Comment (tr|H3C6V3|H3C6V3_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000003974} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
QFAELYESSPWSSYHLHSGITAFSEGAEGLKAFYWSKFSAPEHVAAAVRRSRPERLQRRL
PCSNKVQRCGRDQHSYYMEPEERSDKSKNPNSLQAGKWQLGFQAMSFDLYAKYGNNRTLS
LVSPKKPYYQWRLRVPSGHVVQLVVLTLHGATPGSCSAHKLSAYDFLLPLQNKIIARWCG
LPVSGSSPVMKLTSSGNVMLVTFSFSRQRDGAIFKAYFQAIPKAACGGSISSWNGSVSSP
HYPSFYPPNVDCIWTVKAPLPGYLLSVTIVALDIQDSPSSDGCEKDWLDIGGVKLCNPAS
HSSKKRVHSSPLLVHFHSDESLTNKGFYLLFQAFSPEGACPRQFRCGDGRCIPLRRVCDG
VKDCPDGRDEAKCSSCRPGEVMCGGRCRPEAHPCARPGSCADSSEEGACGGKCSHACPNQ
PCLKRASVCDGVLDCRDRGDELNCTRAYLKGCSSSSYKCSNGKCVNKVNPECDGVKDCPD
GSDELRCRCGTRPRKRTKIVGGSDAGPGSWPWQVSLQMERYGHVCGATLVSSRWLVSAAH
CFQDSDLIKYSDARAWRAYMGMRVMTSGSGGATIRPIRRILLHPKYDQFTSDSDIALLEL
SSPVAFTDLVQPVCVPSPSHTFKTGTSCHVTGWGVLMEDGELASRLQEASVKIISRNICN
KLYDDAVTPRMLCAGNLQGGVDACQGDSGGPLVCLERGRRWFLAGIVSWGEGCARLNRPG
VYTQVVKFTDWIHQQTKG
Download sequence
Identical sequences H3C6V3
ENSTNIP00000003974 ENSTNIP00000003416 99883.ENSTNIP00000003974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]