SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C6Z1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C6Z1
Domain Number 1 Region: 23-134
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.16e-38
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 147-261
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-33
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3C6Z1
Sequence length 261
Comment (tr|H3C6Z1|H3C6Z1_TETNG) CUB domain containing protein 2 {ECO:0000313|Ensembl:ENSTNIP00000004012} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
IEEEVERFFFSFFFFSDHKGFKCGGILSAPSSNISSPNFPSPYPYNSDCSWLIVVAEGSS
VHLTFHHFELEYHASCSYDYIKIYNGVAEDEGNLLGMFCGDVSPPQFTSSWNVMSIIFHS
DRHVAYRGFSVGYRKVKGKELLCFTGECQQVLSAVSGTFSSPRFPNIYPNNINCHWGITQ
AAGYRVKLFFPFMDLEDQNSLSGECDYDSVTVYDGDSQTDAVLGRWCGRERPPSLISRSN
KLLVVLRTDRNGAYRGFTAAY
Download sequence
Identical sequences H3C6Z1
ENSTNIP00000004012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]