SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C733 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C733
Domain Number 1 Region: 1-270
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.41e-60
Family FCH domain 0.0000000821
Further Details:      
 
Domain Number 2 Region: 521-592
Classification Level Classification E-value
Superfamily SH3-domain 5.38e-16
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3C733
Sequence length 602
Comment (tr|H3C733|H3C733_TETNG) Formin binding protein 1-like {ECO:0000313|Ensembl:ENSTNIP00000004054} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
GIDFLERYAKFVKERLEIEQNYAKQLRSLVKKYCPKRSKDEEPRFTSCLSFYSILNELND
YAGQRELVAEEMAHRVYGELMKYSQDLKAERKHHLQEGRKAQQYLDQCWKQMDNSTKKFE
RECRRGREVPLRSLFERLDNEHSTSSPNADVEKDAKNQFYARTHAADESKNEYASQLQNF
NAEQWKHFNNAIPHIFKNLQAMDERRTVKLGETYQSFAEAERRVIPIVSKCLEGMTAAAK
AVDERRDSAIVVESFKSGFEPPGDYPFEDFSQNLSRTGSDGTISNTPKGEREKDGGTGPR
PDPKHNMSRPKNKLWLFGKKPKSPSSAPPPPPPSSSSVFLSSRFSSDKVSHYLSEIKTTV
PRIPHNLRALRRGVSFLKAPSLEDFSHLPPEQRRKRLQQRIDELHKELQKEMDQRDALNK
MKDVYEKNPQMGDPSSLQPKISETICNMEKLRSEIHKNETWLTEVEGKQSSRDRRHSADN
HQRPPQGRESPEGSYTDDTSQEQHTPRHHARPPQPHRNSDPHEFDDEFDDDDPLPVIGHC
KALYGFDGENEGTLSMAEDEVLYIIEEDKGDGWTRARKQTGEEGYVPTSYVDITLEKSSK
GA
Download sequence
Identical sequences H3C733
ENSTNIP00000015292 ENSTNIP00000004054 99883.ENSTNIP00000004054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]