SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C7P2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C7P2
Domain Number 1 Region: 428-668
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.7e-75
Family Fibrinogen C-terminal domain-like 0.000000449
Further Details:      
 
Domain Number 2 Region: 42-231
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 6.05e-62
Family Fibrinogen coiled-coil and central regions 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3C7P2
Sequence length 670
Comment (tr|H3C7P2|H3C7P2_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000004264} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
RRFPSAVLCCFCASAAWLNFRAGSLDPRGARPVEPSTRSENCPSKKEWPFCSDDDWGPKC
PSGCRIQGLMDKHDFSLLKKIEKIRNLLDQNKAKFRTADQASKQTYDYLKDKLTLDSDNS
NKYYALAQNLRRNINDMKIKIDAQLRALAALKDRVRDQVSEMQRLEVDIDIKLRSCKGSC
ERYSAYQMEVGSYVALEKQLKQLDSPSSQSVKGVETLYVMKSRPLKDDPVDSLFKAKDLD
GQQKEDVFHEINTVTLLLEQEGSSSSPATVSKVPGTSFSPSIASSSSASSSKPITELSGP
QDGGLFDGQFDGLSSKTHLSTQTTSCTRFIKTTLVQTAKGPIKEEEEVMKGGPECQTFRD
LSKGELTSLFPTLTLTIHTGGTKQSQLGVSEPGLVNPFDLGAFMMANAEDDVPDLQARSV
KTTRVERKADYVGKDCVEAHQYHLKGESNGLFKIRLGGTKPAQVVEVYCQQEGLMGGWLL
VQQRESGEVSFNRSWAEYRSGFGSVGADGRGEFWLGNQNFHWLTSQSETLLRVEMEDWEG
GAATAEYTVRLGSEEEAFSLHVSGYAGDGGDALLLPGSHMAPFLSHNRMKFSTFDKDNDE
WEQSCAQVHGGGWWYNRCQAANLNGVYYQSANAPENEPAFPGPNGVVWSTFRNSSSSLKA
VRMLIRPAAF
Download sequence
Identical sequences H3C7P2
ENSTNIP00000004264 ENSTNIP00000004264 99883.ENSTNIP00000004264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]