SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C7R6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C7R6
Domain Number 1 Region: 65-305
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.31e-59
Family Ankyrin repeat 0.00000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3C7R6
Sequence length 532
Comment (tr|H3C7R6|H3C7R6_TETNG) Protein phosphatase 1, regulatory subunit 16A {ECO:0000313|Ensembl:ENSTNIP00000004288} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MAADHSELLAEMATVARLSAGERLKHAQKRRGQQLKAWAQMEKESARGSRAKASKKKARL
TKVKFPDAVTLLEATARNDLDEVRQLLNSGVSPDLVNEDGLTALHQCCIDDFVEVVQCLL
DAGACVNACDSELWTPLHAAATCGHTGLVQLLIQAGADLLAVNADGNMPYDLCEDEATLE
LLEIVMAEQVGITQDRIDEFRGVKEAAMLADIQALVQSGGDLNARDDNGATLLHIASANG
YLSVAELLLERRAQVEVKDTDGWTPLHAASCWGHIQVVELLVANGASLNAKSVLDETPLD
LCVDEEVRAKLMDLKHKHDAIMKSQDRQKGTLQKRVSSTGSRGKVVRRVSVNERSSLYRR
EHHKEAMVWQELGRQQEPQDEDEDRQTDNELHQQQATVVSLGNGGASVSLASSVPGELWS
GGGRMERSASYQLNSAAGLGSGPSGSEKGDGMSREKSHHTLADLKRQRAAAKLNKYPAPA
PPLPSPVEEEPSVSSAEASSCPAQASGDPPLLKLIAPEEEPPNNKEPCCGLM
Download sequence
Identical sequences H3C7R6
ENSTNIP00000004288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]