SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C837 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C837
Domain Number 1 Region: 724-998
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.55e-70
Family Protein kinases, catalytic subunit 0.00000844
Further Details:      
 
Domain Number 2 Region: 408-691
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.78e-49
Family Protein kinases, catalytic subunit 0.0000579
Further Details:      
 
Domain Number 3 Region: 248-363
Classification Level Classification E-value
Superfamily SH2 domain 8.99e-18
Family SH2 domain 0.0028
Further Details:      
 
Domain Number 4 Region: 185-263
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000135
Family Third domain of FERM 0.012
Further Details:      
 
Domain Number 5 Region: 30-146
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000272
Family Second domain of FERM 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3C837
Sequence length 1011
Comment (tr|H3C837|H3C837_TETNG) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
IRYYFPGWYSGGASRAYRYGVAKGSESPVFDDCVMSYLFSQWRNDFVNGFVKIPSSHEIQ
EECLGMAVLDMTRTAKERQLSPLDIYHTMSYKSFLPKEIRAQIQDCNFLTRKRIRFRFKR
FIQQFSQCRTTVRDLKLKYLISMESLEKAFYTETFQVRELSRGQLIMTGCSSTMASSGVK
RNFIYVPDQELQILCDFPDVTDISIKQASKEGATESRVVTINKQDGKNLELEFPSLSEAL
SFVSLIDGYYRLTTDAHHYLCKEVAPPRLVEAITSHCHGPISLEFAINQLQKCGNKQGLF
ILQCSPKDFNKYFLTFPVEVYGTVEFKHCQITRSECGQFNLSGTKRNFSSLHELLSCYKN
ETVRSDSVVFQFSKCCPPKAKERSCLLVCRTNKGPEVPLSPSTNRHNISQMVFHKIRKED
LEFNESLGQGTFTKIFKGVRKELGDYGLMHQTEVVMKVLDQAHRNYSESFFEAASMMTQL
SHVHLILNYGVCVCGEENIMVQEYVKFGSLDTYLKKNKNSVNILWKLEVAKQLAQAMNFL
EEKNLVHGNVCAKNVLLIREDDWRAGNPPFIKLSDPGISITVLPKTVLVERIPWVPPECV
NDPANLSLAADKWSFGTTLWEICSGGEKPLASLDNTNKTLFYEDRHQLPAPKWIELANLI
TSCMDYEPTFRPTFRAIIRDLHSLFTPGWFSNMVLFKQQLGKVQTQERQFLFCLESFRTA
SSGANRRLSMLCLLLKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHGTAEHIRDFEREIEI
LKSLQHENIVKYKGVCYSAGRRNLRLVMEYLPFGSLRDYLIKNKERIDHKKLVHYSSQIC
KGMEYLSGKRYIHRDLATRNILVESESRVKIGDFGLTKILPQDKEYYMVREPGESPIFWY
APESLTESKFSVASDVWSFGVVLYELFTHSSRNSSPPTVFMSMMGNDKQGQLIVYHLIEL
LKSGSRLPQPLDCPTEIHEIMEQCWDNDPYLRPSFKELALSIDLFREHKEF
Download sequence
Identical sequences H3C837
ENSTNIP00000004409 99883.ENSTNIP00000004409 ENSTNIP00000004409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]