SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C856 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C856
Domain Number 1 Region: 1115-1311
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000244
Further Details:      
 
Domain Number 2 Region: 898-1024
Classification Level Classification E-value
Superfamily PH domain-like 2.74e-23
Family Pleckstrin-homology domain (PH domain) 0.0000103
Further Details:      
 
Domain Number 3 Region: 32-161
Classification Level Classification E-value
Superfamily PDZ domain-like 9.73e-16
Family PDZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3C856
Sequence length 1900
Comment (tr|H3C856|H3C856_TETNG) Rho GTPase activating protein 21a {ECO:0000313|Ensembl:ENSTNIP00000004428} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
RPKGLTGLGGADGDPRAKKTKQRDGCDQSEAAATDSPSPEEEPFSWQGPKTLRLRRTSQG
FGFTLRHFIVYPPESAVHNSLKDEDNGSRAPGRQRNRLEPMDTIFVKQVKEGGPHRAGLC
TGDRIVKVNGESIIGKTYSQVIALIQNSDASLQLCVMPKDEDILQLTQFSRDISALAYSQ
DAYLKGNEAYSGNAQNIPEPPPICYPRIEVKSAGMTQTSESATVGESLPGSAQGPGRQGG
AAEKSYRVEIPVPPSPTPPQQSLKSPAAVCVCSENARTAPVSLDPVERGSRVARAGPSHR
TEENRYSPSAASVRSKAFSPSVPVFSDKLSSPVRSGTSPVSNDVNHYSPSPPATSQHQTI
DWKNYTTYKDYIDAKRLHTYGCRTIQERLDSLRAAASSGSAYGPQRTPTPPGAGPRGAQG
SQVKRRSTSTDRGVDTSRTARTPSRSASQERLGGERTVTGRVWSRSASEDALPLSSTTGF
TKPRARSCDYLGKQPGESLATVGDKAGFEDRLRLFRGEEGRANRQGPAVAALPYRSLPGK
EGEGQGGALAYPPAAAPVFTKGEADSRTDCVILRPSRLPVKNPLSDPSTILSTIKTSDPL
KDQRAVVIGNHISFPSPLHLQLRGRADSLKTESRAGAVLAARSSSCSGPSSKLPLPRHSE
SGVPASSFGSTAINGDVSQKPAPGGPVRTNGGHFQGVEGPDATVVVLRRDKNSGAPHVRP
PSYVLALDERQKDETTKCWMSDSCRQRHHRRPGDARQKSKHLDDSLDSIPFIDEPSSPSV
DLDSSHIPASALISGAPTITTVPPSPTSPSPLIRRQLSHNHDSPRLTIIESDSGTKTERS
KSYDEGLDNYREEGRGSLFSSLRRSLIPGLKSLRKAEPSSEDSGSRADSLSDVFCDTTKE
GPLQFKQLSADKSKRVGGGMRPWKQMYAVLRGHYLCLYKDKREGQAHANCQTVEEPLPIS
IRSCLIDISYSDTKRKNVLRLTTSDCEYLFQEDREDMLAWIRVIQENGNLDEENSAFTSH
DLISRKIREYTTLMSPTGSKTEPSPKSSRQSLSIKHTLLGSKAETKATSPHSRPEQDRKS
VHKDDTSPPKDKGTWRGIPGLMRKPFEKKPSPGVTFGVRLDDCPPAQTNKFVPLIVEVCC
KLVEERGLEYTGIYRVPGNNAAISNMQEELNNKGMNDIDIQDDKWRDLNVISSLLKSFFR
KLPEPLFTNDKYADFIEANRTEDPVERLKVLKRLLHQLPEHHYETLKFLSAHLKTVAENS
EKNKMEPRNLAIVFGPTLVRTTDDNMTHMVTHMPDQYRIVETLIQNYDWFFTEEGNGEPV
TVSREESAVESQPVPNIDHLLTNIGRTGTSQGEVSDSPTSDSAKSKGSWSSAKDQCTRDL
LVSSIFAAASRKRRKSKEKPQPSSSDDDLDSVFLKRDVPGQKPNSQHLLQAESQSGPGPK
TTRPAPADGREVNGRAVEPAPKAKREHRISLFLKDTTPPRHPSPCPSPGVPQLAPQGKSS
GSDPPSQLEENTSDLGTMSSGASGPRSRPKKWSTGTCADRSAGAEVSSITSDYSTTSSIT
FLTGAESSALSPELHAGEEADDERSELVSEGRPMETDSESDFPVFAPEGRNSQSTPRSRQ
SLEKSERQGDVEGATAGKLEARRLFPTHRMIECDTLSRRWSLRQKTDSESSAEALAGGGE
ATEAKVESSTRLSRVLGVIKKGRSSSSVSSSSRSEPERHEAAWHLKITERLKLRLRTSAD
DMFTQKNPMPEARGKKKNIRRRHTMGGQRDFAELAIISDWREPGGVDQTAPLSALERLKP
RCSSQDFSPRDWTSRDRCRGSVSSVEVAPKAVPEDDHQDMREAAAEQPQGSSTSNSQPLP
GEHVNGGRLQSKNKGNLGVDPHPHKLSGAQVVRSRFYQYL
Download sequence
Identical sequences H3C856
ENSTNIP00000004428 99883.ENSTNIP00000004428 ENSTNIP00000004428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]