SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C8T5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C8T5
Domain Number 1 Region: 18-178,218-281
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.62e-64
Family BAR domain 0.00058
Further Details:      
 
Domain Number 2 Region: 324-395
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000561
Family SH3-domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3C8T5
Sequence length 396
Comment (tr|H3C8T5|H3C8T5_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000004657} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MDFNMKKLASDAGLFFTRAVQFTEEKLGQAEKTELDPHLENLLARADATKNWTEKVLRQT
EALLQPNPSARIEEFIYDKLDRKLPSKVTNAELLGQHMLDAAADLGPETPYGSTLTTVGE
YQKRLGGAEREFLYIATANFLTPLRNFLEGDWRTISKERRLLENRRLDLDICKARVKKAK
QAEAKAAAAPDFQETRPRNYVLSASASALLSEEVDKVRRSRELRVAQTEFDRQAEVTRLL
LEGISSTHLNHLRCLHDFAEAQASYYAQCHHYTQELQRELSRRRRRKASAAPAADSSPCL
FPHRCANPAAAAPKPSAAASSSHSALGVEQTPLAVTGTRKAKVLYDYDAHDASELSLLAD
ELITVYTVPGMDPDWLVGERGNDKGKVPVTYLELLS
Download sequence
Identical sequences H3C8T5
ENSTNIP00000004657 ENSTNIP00000004657 99883.ENSTNIP00000004657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]